KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1367Help
Entry
XCC1367           CDS       T00083                                 

Gene name
dxr
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00900  Terpenoid backbone biosynthesis
xcc01100  Metabolic pathways
xcc01110  Biosynthesis of secondary metabolites
xcc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XCC1367 (dxr)
Enzymes [BR:xcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     XCC1367 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 1001769
NCBI-ProteinID: NP_636741
UniProt: Q8PAV9
Position
complement(1591851..1593041)
Genome map
AA seq 396 aa AA seqDB search
MSGSSLRRVAVFGATGSIGASALDVIARHPERLRASVLSAGSKVDALLALCVLHRPAHAV
IADAALYPALRDGLRAAGLTTQAHAGDQALDALAASDACDTVVAAIVGAAGLSSTLAAAA
AGKRLLLANKESLVLAGELLTRTAAAAGAEIIPIDSEHSAIFQCLRSCDASRGVRRVILT
ASGGPFRGRQRAQLAEVTPAQAVAHPKWSMGPKISVDSATLMNKGLEVIEAHHLFGLPGE
QIDVLVHPQSLVHSLVEFVDGSTLAQLGLPDMRTTLAVGLAWPERVESGVGGLDLLQQGR
LDFEAPDTEAFPCLRLAWDALRAGGTAPAILNAANEVAVSAFLQGKVGFLAIPALVEHTL
TTLQRQNADTLNALLFADAEARRTTERALAHHSLHA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggttcttctcttcgtcgggtcgccgtgttcggcgcgaccggctccatcggtgcc
tcggcactggacgtgattgcccggcatccggagcggctgcgtgccagcgtgctgtcggcc
ggcagcaaggtcgatgcgctgctggcgttgtgcgtgctgcaccgccccgcccacgcggtg
atcgccgacgccgcgttgtatccggcattgcgcgatggtttgcgcgccgccggcctgacc
acccaggcgcatgccggtgatcaggcgctggacgcgctggcggccagcgatgcctgcgac
accgtggtggcggcgatcgtcggcgccgccggcctgtcgtccaccctggcggccgcggcc
gccggcaagcgcctgttgctggccaacaaggaatccctggtgctggccggcgagctgctg
acccgcaccgcggctgcggccggcgcggagatcattccgatcgacagcgagcacagtgcg
atctttcagtgcctgcgctcctgcgacgccagccgcggggtgcggcgggtgatcctgacc
gcctccggcgggccgttccgcggccgccagcgtgcgcaattggccgaagtgacgcccgcc
caagcggtggcgcacccgaaatggtcgatggggccgaagatctcggtcgactcggccacg
ctgatgaacaagggcctggaagtgatcgaggcgcaccatctattcggcctgcccggcgag
cagatcgacgtgctggtgcacccgcagagcctggtgcattcgttggtggaattcgtcgac
ggctccaccttggcccagctcgggctaccggacatgcgcaccaccctggcggtcggcctg
gcctggccggagcgcgtcgagtccggcgtcggcggcctggatctgctgcagcaaggccgg
ctggacttcgaagctccggacaccgaggcgttcccgtgcctgcgcctggcctgggacgcc
ttgcgcgccggcggcaccgcgccggcgatcctgaacgcagccaacgaagtggctgtttca
gcgtttcttcagggcaaggtgggtttcctagccatccctgcgttggtcgaacacacgctg
acaacgcttcagcggcagaatgccgataccctgaatgctctccttttcgccgatgccgaa
gcacggcgaaccactgaacgcgccctcgcccatcattcccttcatgcctga

DBGET integrated database retrieval system