KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1420Help
Entry
XCC1420           CDS       T00083                                 

Definition
(RefSeq) phospholipase
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00564  Glycerophospholipid metabolism
xcc00565  Ether lipid metabolism
xcc00590  Arachidonic acid metabolism
xcc00591  Linoleic acid metabolism
xcc00592  alpha-Linolenic acid metabolism
xcc01100  Metabolic pathways
xcc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    XCC1420
   00565 Ether lipid metabolism
    XCC1420
   00590 Arachidonic acid metabolism
    XCC1420
   00591 Linoleic acid metabolism
    XCC1420
   00592 alpha-Linolenic acid metabolism
    XCC1420
Enzymes [BR:xcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     XCC1420
    3.1.1.32  phospholipase A1
     XCC1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1 VasI
Motif
Other DBs
NCBI-GeneID: 1001837
NCBI-ProteinID: NP_636793
UniProt: Q8PAQ8
Position
complement(1654427..1655557)
Genome map
AA seq 376 aa AA seqDB search
MSKQRARPLMLIALAAAPLAHAQEIAPQPASPQACTSVTSDAARLACYDQALGYTPQAVQ
EADAAAQLAKQAAKSEDTRKISRVGDFFRADGQDQPKEEAVANAGRGSLLDRRWELAKDS
KLGTFQLRGYKPVYLLPAFWTSDTNRTPQSPNPANSVSTPQQLDSAELKFQLSFKTKVVE
DLFGDNGDIWMGYTQSSRWQAYNSDASRPFRETNYEPEAMLVFRNNYSIFGWKGRMSGIS
INHMSNGREDPLSRSWNRVILNIGLDRENWALTLRPWFRIKEDRADDNNPDIEDYMGRGD
ATLVYNKDGHEFALIARHSLRGGDRSHGSVQLDYGFPITNLLRGHVQVFDGYGESLIDYN
HKATYVGVGVSLLEWF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcaacgtgcccgtcccctaatgctgatcgccctggccgctgcgccgctggcg
cacgcgcaggaaatcgctccacagccagcatcgccgcaggcctgtacctccgtgacttcg
gatgccgcgcgtctggcgtgctacgaccaggcgctgggatataccccgcaggccgtgcag
gaggcagatgccgccgcgcagttggccaagcaggccgccaaatcggaagacacccgcaag
atcagccgcgtgggcgatttcttccgcgccgacggccaggaccagccgaaggaagaagcg
gtcgccaatgccggccgcggctcgctgctggatcgccgctgggagctggccaaggattcc
aagctggggaccttccagctgcgcggctacaagccggtctatctgttgccggcattctgg
accagcgacaccaaccgcacgccgcagtcgccgaacccggccaactcggtcagcacgccg
cagcaactggacagcgccgagctgaagttccagctgagcttcaagaccaaggtggttgag
gatctgttcggcgacaacggcgatatctggatgggctatacccagagctcgcgctggcag
gcctataactccgatgcctcgcgcccgttccgcgagaccaattacgagccggaagcgatg
ctggtgtttcgcaacaactacagcatcttcggctggaaaggccgcatgagcggcatcagc
atcaatcacatgtccaacggccgcgaagacccgctgtcgcgttcctggaaccgggtgatc
ctcaatatcggcctggatcgcgaaaactgggcgctgacgttgcgcccgtggttccgtatc
aaggaagaccgtgccgacgacaataatccggacatcgaggattacatgggccgcggcgac
gccaccctcgtctataacaaggatggccacgaattcgccttgattgcccggcattcgctg
cgtggcggcgaccgctcgcacggctcggtgcaactggattacggcttcccgatcaccaac
ctgttgcgcggccacgtgcaggtgttcgacggctatggcgagagcctgatcgactacaac
cacaaggccacctatgtgggcgtgggcgtgtcgttgctggaatggttctga

DBGET integrated database retrieval system