KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1432Help
Entry
XCC1432           CDS       T00083                                 

Gene name
wbpS
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XCC1432 (wbpS)
Enzymes [BR:xcc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     XCC1432 (wbpS)
Peptidases [BR:xcc01002]
 Cysteine Peptidases
  Family C44
   XCC1432 (wbpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1665442..1667385
Genome map
AA seq 647 aa AA seqDB search
MCGLAGLLLATPRMHGEQLEALVRPMGGALRHRGPDDAGTWCDAQAGVALAHQRLSILDL
SPLGHQPMRSADSRYVLAYNGEIYNFAQLRAALAALGHRFRGHSDTEVLLAAVVEWGLDD
TLARCNGMFALALWDERDHCLSLARDRVGKKPLYYGWAGDTLVFGSELKALWQHPDFDNG
VDRDALTLLLRLGYIPAPACIHERTFKLMPGRVLRLDAQAVAAGAAAHRPDQAQQPFWNA
REAMQRALAAPFTGTDAQAEEQLDSLLRDAVALRMVADVPVGVFLSGGTDSSIVTAMMQA
QSDQPVHTFSIGFEGSHHDEAPLAREVATHLHTDHTELYVSGADALAVVPTLPDMFDEPF
ADASQVPTALVARLARGGVTVALSGDGGDELFFGYGRYQRALRNWRMHGLVPAPLRRLMA
VAARKSGEASRTGGLAALVAEAGARGIGDIYRNRISRWRDPAAVVLGATEPDSFYSLADP
LHGSGTPADAMMLADFAAYLPDDLLCKVDRTTMAVGLEARAPLLDWRVAEFAWSLPLSLK
YRDGVSKYLLKRVLCRYLPEPMVYRGKRGFGAPVSAWLRGDLHGWADDLLAHGTLQREGV
FAADTVAGLWRDFNGGERKWHTHLWTVLMFQAWQDHWRAQRAAIVRS
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggattggcaggactgttgctggcaacaccgcgcatgcacggcgagcagctggag
gcattggtgcggccgatgggcggcgccttgcgccaccgtggcccagacgatgccggtacc
tggtgcgatgcgcaggccggcgttgcgctggcccaccagcgcctgagcatcctggatctc
tctccgctcggccatcagccgatgcgctcggccgacagccgctacgtgctggcctacaac
ggcgagatctacaacttcgcgcagttgcgcgcggcgctggcggcgctcgggcaccgcttc
cgcgggcattcggataccgaagtgctgctggccgcagtggtggagtggggcctggacgac
accctggcgcgctgcaacggcatgttcgcgctggcgctgtgggacgaacgcgaccattgc
ctgtcgttggcccgtgaccgcgtgggcaagaagccgctgtactacggctgggccggtgac
acgctggtgttcggctccgagctcaaggcgctgtggcagcacccggatttcgacaacggc
gtggaccgcgatgcgctcaccctgctgttgcggctgggctatatcccggcgccggcctgc
atccacgagcgtaccttcaagctgatgcccgggcgggtgctgcggctggacgcccaagcg
gtggccgccggcgccgccgcacaccggcccgaccaggcccagcaaccgttctggaatgcc
cgcgaggccatgcagcgtgcgctggccgcgccattcaccggcaccgatgcccaggccgaa
gagcagctggatagtctgctgcgcgatgcagtggcgttgcgcatggtggccgacgtgccg
gtgggcgtgttcctgtctggcggcaccgattcgtcgatcgtcaccgcgatgatgcaggcg
cagagcgaccagccggtgcacaccttcagcatcggctttgagggctcgcaccacgacgaa
gcgccgctggcgcgcgaagtggccacgcacctgcacaccgatcacaccgagctgtatgtc
agcggcgccgatgcgctggcggtggtgccgaccttgccggacatgttcgacgaaccgttc
gccgacgcctcgcaggtgcccaccgcgctggtggcgcggctggcgcgcggtggcgtcacc
gtggcgctatccggcgatggcggcgacgagctgttcttcgggtatgggcgctaccagcgc
gcgctgcgtaactggcgcatgcacgggctggtgccggcgccgctgcggcgcctgatggcg
gtggcagcgcgcaagagcggcgaagcctcgcgcaccggcgggctggcggcactggtggcc
gaggcgggcgcacgcggcatcggcgacatctaccgcaaccgcatctcacgctggcgcgac
ccggccgcggtggtgctgggcgcgaccgagccagacagtttttacagcctggccgatccg
ctgcatggctcgggcacgccggccgacgcgatgatgctggccgacttcgctgcgtatctg
ccggacgatctgctgtgcaaggtcgaccgcaccaccatggcggtggggctggaggcgcgc
gcgccgctgctggattggcgcgtggccgagttcgcctggtcgttgccgctctcactcaag
taccgcgatggggtcagcaagtacctgctcaagcgcgtgctgtgccgctatctgcccgag
ccgatggtctaccgcggcaagcgtggcttcggtgcgccggtgagtgcgtggctgcgcggc
gacctgcatggctgggccgacgatctgctggcacacggcacgctgcagcgcgaaggcgtg
ttcgccgccgataccgtggccgggctgtggcgcgacttcaatggcggcgagcgcaagtgg
cacacccacctgtggacggtgctgatgttccaggcctggcaggaccactggcgcgcgcag
cgggctgccatcgtccggtcgtag

DBGET integrated database retrieval system