KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1486Help
Entry
XCC1486           CDS       T00083                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00020  Citrate cycle (TCA cycle)
xcc00310  Lysine degradation
xcc01100  Metabolic pathways
xcc01110  Biosynthesis of secondary metabolites
xcc01120  Microbial metabolism in diverse environments
xcc01130  Biosynthesis of antibiotics
xcc01200  Carbon metabolism
Module
xcc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xcc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XCC1486 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    XCC1486 (sucB)
Enzymes [BR:xcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     XCC1486 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H SAPS
Motif
Other DBs
NCBI-GeneID: 1001907
NCBI-ProteinID: NP_636858
UniProt: Q8PAJ7
Position
complement(1737390..1738604)
Genome map
AA seq 404 aa AA seqDB search
MATEVKVPVLPESVSDATIASWHKKAGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK
FEAGSTVTSNQILAIIEEGAVAAAAPAEEKKADATAAAAAPAAAPAPAAAAAAAPVASKS
SADSLPPGARFSAITQGVDPSQVDGTGRRGAVTKEDIVNFAKAGGVGKASGARPEERVAM
TRVRKTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKELQDEFQKAHGIKLGFMSFFVKA
AANALQRFPLVNASIDGDDIIYHGYSDISIAVSTEKGLVTPVLRNVERQSFAEVEQGIAD
YAAKARAGKLGLDDLQGGTFTITNGGTFGSLLSTPIINPPQSAILGMHAIKERPIAENGQ
VVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRMLFGL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtcaaagttccggtactgcccgaatccgtttccgacgccaccatcgcc
agctggcacaagaaggccggtgaagcggtcaagcgcgacgagaatctggtcgatctggaa
accgacaaggtcgtgttggaagttccttcgccggtcgacggcgtactgaaggaaatcaag
ttcgaagccggcagcacggtcaccagcaaccagatcctggcgatcatcgaagaaggcgcc
gtggccgcagctgcaccggccgaagagaagaaggccgatgccacggcggccgccgctgcg
cctgctgctgcgccggcaccggctgccgctgccgctgccgcgccggttgcatcgaagtcg
tctgctgacagcctgccgccgggtgcgcgtttttccgccatcacccagggcgtggatccg
tcgcaggtcgacggcaccggccgtcgtggcgcggtgaccaaggaagatatcgtcaacttc
gccaaggccggcggcgtgggcaaggcgtctggcgcccgtcctgaagagcgcgtggcgatg
acccgcgtgcgcaagacgatcgccaagcgcctgatggagtccaagaactccaccgcgatg
ctgaccaccttcaacgaggtcaacctcgccaaggtgtcggccgcgcgcaaggaactgcag
gacgaattccagaaggcgcacggcatcaagctcggtttcatgagcttcttcgtcaaggcc
gcggccaacgcactgcagcgcttcccactggtcaacgcctcgatcgacggcgacgacatc
atctatcacggctacagcgacatctcgatcgccgtctccaccgagaagggcctggtgacg
ccggtgctgcgtaacgtcgagcgccagtcatttgccgaagtcgaacagggcatcgccgac
tacgccgccaaggcgcgcgccggcaagctgggcctggacgacctgcagggtggcaccttc
accatcaccaatggcggcaccttcggctcgctgttgtcgaccccgatcatcaacccgccg
cagagcgccatcctgggcatgcacgcgatcaaggaacgtccgatcgccgagaacggccag
gtcgtgatcgcgccgatgatgtacctggcgctgtcctacgaccaccgcatcatcgacggc
aaggattcggtgcagttcctggtcgacatcaagaatcagctggaaaacccgggccggatg
ctgtttggcctctaa

DBGET integrated database retrieval system