KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1501Help
Entry
XCC1501           CDS       T00083                                 

Gene name
btuE
Definition
ABC transporter vitamin B12 uptake permease
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:xcc00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:xcc00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1754837..1755394
Genome map
AA seq 185 aa AA seqDB search
MSLNRLLVLVFAGLFSTAAVAAGTSVLDLDYRPLAGKAPINLNRSYGGKVVMVVNTASKC
GFTPQYEGLEALNQRFGSRGFTVLGFPSNDFQGQEPGSEKQIQEFCTLTYGVKFPMFEKV
HVLGAQATPLYQRLTRETGVAPGWNFHKYLIGRNGHVVAQFPSKVKPDDPQVLAAIEREL
KAPAR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcaatcgtctgttggtccttgtatttgctggacttttttccactgctgcggtg
gcagccggtacctcggtgctggatctggactatcgcccgctggccggcaaggccccaatc
aacctgaaccgtagttacggcggcaaggtggtgatggtggtcaacaccgccagcaagtgc
ggcttcaccccgcagtacgaaggcctggaagcgctcaatcagcgcttcggcagccgcggg
ttcacggtgctcggcttcccgtccaacgatttccaggggcaggaacccggatctgagaaa
cagatccaggaattctgcacgctgacctatggcgtcaagttcccgatgtttgagaaggtg
catgtgctgggcgcgcaggcgaccccgctgtatcagcgactgacgcgcgagaccggcgtg
gcgccgggttggaacttccacaagtatttgatcggtcgcaatggacatgtggtggcgcag
ttcccgagcaaggtcaagccggacgatccgcaggtgctggcggcgatcgagcgcgagctc
aaggcgccagcacgctga

DBGET integrated database retrieval system