KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1501Help
Entry
XCC1501           CDS       T00083                                 

Gene name
btuE
Definition
ABC transporter vitamin B12 uptake permease
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    XCC1501 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XCC1501 (btuE)
Enzymes [BR:xcc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XCC1501 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1754837..1755394
Genome map
AA seq 185 aa AA seqDB search
MSLNRLLVLVFAGLFSTAAVAAGTSVLDLDYRPLAGKAPINLNRSYGGKVVMVVNTASKC
GFTPQYEGLEALNQRFGSRGFTVLGFPSNDFQGQEPGSEKQIQEFCTLTYGVKFPMFEKV
HVLGAQATPLYQRLTRETGVAPGWNFHKYLIGRNGHVVAQFPSKVKPDDPQVLAAIEREL
KAPAR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcaatcgtctgttggtccttgtatttgctggacttttttccactgctgcggtg
gcagccggtacctcggtgctggatctggactatcgcccgctggccggcaaggccccaatc
aacctgaaccgtagttacggcggcaaggtggtgatggtggtcaacaccgccagcaagtgc
ggcttcaccccgcagtacgaaggcctggaagcgctcaatcagcgcttcggcagccgcggg
ttcacggtgctcggcttcccgtccaacgatttccaggggcaggaacccggatctgagaaa
cagatccaggaattctgcacgctgacctatggcgtcaagttcccgatgtttgagaaggtg
catgtgctgggcgcgcaggcgaccccgctgtatcagcgactgacgcgcgagaccggcgtg
gcgccgggttggaacttccacaagtatttgatcggtcgcaatggacatgtggtggcgcag
ttcccgagcaaggtcaagccggacgatccgcaggtgctggcggcgatcgagcgcgagctc
aaggcgccagcacgctga

DBGET integrated database retrieval system