KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1667Help
Entry
XCC1667           CDS       T00083                                 

Gene name
cycA
Definition
cytochrome C2
Orthology
K08738  
cytochrome c
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    XCC1667 (cycA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XCC1667 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1940900..1941271)
Genome map
AA seq 123 aa AA seqDB search
MCAPLAGLLLAGATLAPPARAADGAGKDTFMAECAECHSATQGKNKKGPSMFGIGNRQAA
SLPDYSNYSDALKNSKWQWTPAQLKTYLSQSSSKALPGTKMKYEGLDDPKELDALIVYLN
SLK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcgccccgctcgccggcctgctattggccggcgccaccctggcaccgccggcgcgt
gccgccgacggtgcgggcaaggacaccttcatggccgaatgcgccgaatgccacagcgca
acgcaaggcaagaacaagaaaggcccgtccatgttcggcattggcaaccgccaggcggcc
agcctgccggactacagcaactactccgacgcgctcaagaacagcaagtggcagtggacg
ccggcacagctgaagacctacctgtcgcagtcttcgtccaaggcgctgcccggcaccaag
atgaagtacgaaggcctggatgatcccaaggagttggacgcactcatcgtctatctcaac
agcctcaaatga

DBGET integrated database retrieval system