KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1714Help
Entry
XCC1714           CDS       T00083                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xcc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1989566..1990474
Genome map
AA seq 302 aa AA seqDB search
MPMFDTTPQLNCAGRLLRLDGPQVMGIVNVTPDSFSDGGQHTTVDAAVAHGLRLVAEGAA
VLDVGGESTRPGANAVSVEEELQRVIPVIQALSAQTAVPISVDTYKPEVMRAAVGAGAGM
INDVHALRSPGALEAAAELAVPVVLMHARSAPHAMQAEPHYDDVVAEVHRFLAERIFAAE
MAGIDKRRLILDPGFGFDKSTAHNLTVLAQLQRLQEFGLPVLAGFSRKRTIGELTGRQVA
ADRVHGSVAAHLIAAQQGAQLLRVHDVAATVDALKVWRAVAAIPTPRAAAPAAPTIRWPD
ED
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ttgccgatgtttgacaccacaccgcaattgaactgcgccggccgcctcctgcgcctggat
ggcccgcaggtgatgggcatcgtcaatgtcacgccggactcgttctccgatggcggtcag
cacacgacggtggacgcggcggtggcccatgggctgcgactggtcgcagaaggtgcggcg
gtgctggatgtgggcggtgaatccacccggcctggcgccaatgcggtatcggtggaagag
gagctgcagcgggtgatcccggtgatccaggccctgagcgcgcagaccgctgtgccgatc
agcgtggacacctacaagcccgaggtcatgcgcgccgcagtcggcgcgggcgcgggcatg
atcaacgatgtacacgcgttgcggtcgccgggcgcgctggaggcggctgcggaactcgcg
gtgccggtggtgctgatgcatgcgcgcagcgcaccgcatgcgatgcaggccgagccgcat
tacgacgatgtggtggccgaggtgcatcgctttctggccgagcgtatttttgctgcggaa
atggccggcatcgacaagcgtcggctgatcctcgaccccggattcggcttcgacaagagc
accgcgcacaacctcaccgtgctggcgcaactgcagcggctgcaagaatttggcctgccg
gtgctggcgggattctcgcgcaagcgcacgatcggtgaattgaccggtcgccaggttgcg
gccgaccgcgtgcatggctcggtggccgcgcatctgatcgccgcccagcagggcgcgcaa
ctgctgcgcgtgcatgacgtggcggcgaccgtggatgcgttgaaggtatggcgtgcggtg
gctgcaattcccaccccgcgcgcggcagcacctgcggcgccgacgattcgctggccggac
gaggactga

DBGET integrated database retrieval system