KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1714Help
Entry
XCC1714           CDS       T00083                                 

Gene name
folP
Definition
(RefSeq) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00790  Folate biosynthesis
xcc01100  Metabolic pathways
Module
xcc_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XCC1714 (folP)
Enzymes [BR:xcc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     XCC1714 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-GeneID: 998379
NCBI-ProteinID: NP_637084
UniProt: Q8P9X9
Position
1989566..1990474
Genome map
AA seq 302 aa AA seqDB search
MPMFDTTPQLNCAGRLLRLDGPQVMGIVNVTPDSFSDGGQHTTVDAAVAHGLRLVAEGAA
VLDVGGESTRPGANAVSVEEELQRVIPVIQALSAQTAVPISVDTYKPEVMRAAVGAGAGM
INDVHALRSPGALEAAAELAVPVVLMHARSAPHAMQAEPHYDDVVAEVHRFLAERIFAAE
MAGIDKRRLILDPGFGFDKSTAHNLTVLAQLQRLQEFGLPVLAGFSRKRTIGELTGRQVA
ADRVHGSVAAHLIAAQQGAQLLRVHDVAATVDALKVWRAVAAIPTPRAAAPAAPTIRWPD
ED
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ttgccgatgtttgacaccacaccgcaattgaactgcgccggccgcctcctgcgcctggat
ggcccgcaggtgatgggcatcgtcaatgtcacgccggactcgttctccgatggcggtcag
cacacgacggtggacgcggcggtggcccatgggctgcgactggtcgcagaaggtgcggcg
gtgctggatgtgggcggtgaatccacccggcctggcgccaatgcggtatcggtggaagag
gagctgcagcgggtgatcccggtgatccaggccctgagcgcgcagaccgctgtgccgatc
agcgtggacacctacaagcccgaggtcatgcgcgccgcagtcggcgcgggcgcgggcatg
atcaacgatgtacacgcgttgcggtcgccgggcgcgctggaggcggctgcggaactcgcg
gtgccggtggtgctgatgcatgcgcgcagcgcaccgcatgcgatgcaggccgagccgcat
tacgacgatgtggtggccgaggtgcatcgctttctggccgagcgtatttttgctgcggaa
atggccggcatcgacaagcgtcggctgatcctcgaccccggattcggcttcgacaagagc
accgcgcacaacctcaccgtgctggcgcaactgcagcggctgcaagaatttggcctgccg
gtgctggcgggattctcgcgcaagcgcacgatcggtgaattgaccggtcgccaggttgcg
gccgaccgcgtgcatggctcggtggccgcgcatctgatcgccgcccagcagggcgcgcaa
ctgctgcgcgtgcatgacgtggcggcgaccgtggatgcgttgaaggtatggcgtgcggtg
gctgcaattcccaccccgcgcgcggcagcacctgcggcgccgacgattcgctggccggac
gaggactga

DBGET integrated database retrieval system