KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1803Help
Entry
XCC1803           CDS       T00083                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xcc01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:xcc00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:xcc00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2103610..2104914
Genome map
AA seq 434 aa AA seqDB search
MFISTRGAAPAVSLSQAIAAGLAPDGGLYVPQTLPPARTLQAGATLADTATTLLQPFFEG
DALAGELAAICAEAFDFPAPLVPLATPGDYALELFHGPTAAFKDFGARFLAACLTRLRRA
EDRPLTILVATSGDTGAAVAAAFHRQPGLRVVVLYPDGRVSPRQAHQLGCFGDNIQALRV
AGTFDDCQAMVKQALNDGELQAQLPLSSANSISLGRLLPQMSYYAHAALQHHAGSGAALN
LVVPTGNLGNGLAAILARALGVPLGQIVLASNANHVLPDYFAGDDYAPQPSVATVANAMD
VGAPSNFERLRWLYDGDDAALREAFRALSVDDTAIRHTVQQRFARYGEVHCPHTATAVHV
LEQLRAEGVEGGTGDWAVAATAHPAKFEAVVEPLIGRAVEIPPALAALLQRPAHAEPLAP
DYLAFRQRLLADAP
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgttcatctctacccgtggcgccgcacctgccgtgagcctgagccaggcgatcgccgcc
ggcctggccccggacggcggcctgtacgtgccgcagaccctgccgccggcgcgcaccctg
caggccggcgcaacgctggccgacacggccaccacactgctgcagccgttcttcgaaggt
gacgcgctggcaggcgagctggcggccatctgcgccgaagcgttcgatttcccggcgccg
ctggtgccgctggccacgccgggcgactacgcgctggagctattccatggccccaccgcg
gccttcaaagattttggtgcgcggtttctggccgcttgtctgacgcggctgcggcgcgcc
gaagaccgcccgctgaccattctggtggctacctccggcgataccggcgcggccgtggcg
gcggcgttccatcggcagcccggcctgcgggtggtggtgctgtatccggatggccgcgtg
tcgccccggcaggcgcatcagctgggctgcttcggcgacaacatccaggcattgcgtgtg
gccggcaccttcgacgactgccaggccatggtcaagcaggccttgaacgatggcgagctg
caggcgcagctgccgctgagttcggccaatagcatcagcctggggcggctgctgccgcag
atgagctactacgcgcacgcagcgctgcagcaccacgctggctccggggccgcattgaac
ctggtggtgcccaccggcaacctgggcaacggcctggccgcgatcctggcacgcgcgctc
ggcgtgccgctgggccagatcgtgctggcgtccaacgccaaccatgtgttgcccgactac
ttcgccggcgacgactacgcaccgcaacccagcgtggccaccgtggccaacgcgatggac
gtgggtgcacccagcaatttcgaacgcctgcgttggctgtatgacggcgacgatgcggcc
ctgcgcgaggcgttccgtgcgctgtcggtggatgacacggcgatccgccataccgtgcag
caacgcttcgcacgctacggcgaggtgcattgcccgcataccgccaccgccgtgcacgta
ctggagcaattgcgcgcggaaggggtcgagggcggcaccggcgactgggcggtggcggcc
acggcgcacccggccaagttcgaggcggtggtggagccactgatcggccgcgcggtggag
attccgccggcgctggcggcgctgttgcagcgtccggcgcatgccgaaccgctggcaccg
gactacctggcgttccggcagcgtctgctcgcggatgcgccctga

DBGET integrated database retrieval system