KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1809Help
Entry
XCC1809           CDS       T00083                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00340  Histidine metabolism
xcc01100  Metabolic pathways
xcc01110  Biosynthesis of secondary metabolites
xcc01230  Biosynthesis of amino acids
Module
xcc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    XCC1809 (hisD)
Enzymes [BR:xcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     XCC1809 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 999104
NCBI-ProteinID: NP_637174
UniProt: Q8P9P2
Position
2109632..2110927
Genome map
AA seq 431 aa AA seqDB search
MNTLDWTQLTADARTQALTRPVQTVATQTREAVATLIADVRARGDVALREITARFDGVTL
ESFAVSDAEFAAADAAIAPELRQAMQDAVARIDTFHRAGMSEGYAVETAPGVVCEKIVRP
IGRVGLYVPAGSAPLPSTALMLGVPARLAGCREVVLCTPPRKDGSVDPAVLVAAQLTGVR
RVFKLGGAQAIAAMAYGTDSIPSCDKLFGPGNSFVTEAKQQVAQSGAAAIDMPAGPSEVL
VIADAGAQPAFVAADLLSQAEHGPDSQVLLLSDSDALITAVQEQLDLQLAQLSRADIARQ
ALAQSRLIKVATLQDAFEISNRYAPEHLILALREPRAWLAQVEAAGSVFLGDYTPEALGD
YCSGTNHVLPTSGAARAYSGVSVASFQNMVSVQAASKAGIDGIGACAVILARAEGLDAHA
NAVALRMGVAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcttgattggacccaactcactgcagacgcacgcacccaggcgttgacgcgc
ccggtgcagaccgtcgccacgcagacacgcgaggcggtcgccaccctgatcgccgatgtg
cgtgcacgtggcgatgtggcgctgcgcgagatcaccgcacgcttcgacggcgtcacgctg
gagagctttgcggtcagcgatgccgaatttgccgcggcagatgccgccatcgcgccggaa
ctgcgccaggcgatgcaggacgccgtggcgcgcatcgacacctttcaccgcgccggcatg
agcgaaggctatgcggtggaaaccgcacctggcgtggtctgcgaaaagatcgtgcgcccg
atcggccgcgtgggcctatacgtgccggccggcagcgcgccgttgccgtccaccgccttg
atgctgggcgtgccggcgcggctggctggctgccgcgaagtggtgctgtgcacgccgccg
cgcaaggatggcagtgtcgacccggcggtgctggtggccgcgcaactcaccggcgtgcgc
cgagtattcaagctcggtggcgcgcaggcgattgcggcaatggcctatggcaccgactcc
attcccagctgcgacaaattgttcggcccgggcaacagcttcgttaccgaagccaagcag
caggtggcgcaatccggcgcggccgcgatcgacatgccggccggcccgtccgaggtgctg
gtgattgccgatgccggcgcgcaaccggcatttgtcgcggccgatctgttgtcgcaggcc
gaacatggcccggattcgcaagtactgctgttgtccgacagcgatgcattgattaccgca
gtgcaggagcaactggacctgcaactggcgcaactctcgcgcgccgacatcgcgcgccag
gcgttggcgcagtcgcggttgatcaaggtggcgacgctgcaggacgcgttcgagatcagc
aaccgctatgcaccggagcacctgatcctggccttgcgcgagccgcgtgcgtggttggcg
caggtggaggccgccggctcggtatttctcggcgactacacgcccgaagcactgggcgat
tactgcagcggcaccaaccacgtgttgccgaccagcggtgcggcgcgtgcctatagcggc
gtgagcgtggccagcttccagaacatggtgagcgtgcaggcggcgagcaaggccggtatc
gatggaatcggcgcatgcgcagtgattctggcgcgcgccgagggcctggatgcgcacgcc
aacgcggtggcgctgcgcatgggagtggccgcatga

DBGET integrated database retrieval system