KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC2013Help
Entry
XCC2013           CDS       T00083                                 

Gene name
rfbD
Definition
(RefSeq) strX protein
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00521  Streptomycin biosynthesis
xcc00523  Polyketide sugar unit biosynthesis
xcc01130  Biosynthesis of antibiotics
Module
xcc_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    XCC2013 (rfbD)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XCC2013 (rfbD)
Enzymes [BR:xcc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     XCC2013 (rfbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-GeneID: 998631
NCBI-ProteinID: NP_637378
UniProt: Q8P953
Position
complement(2362617..2363198)
Genome map
AA seq 193 aa AA seqDB search
MIFRPTPLSGAFIIEPEPRGDARGWFARVFCTQEMAQAGLVDQFVQVNNSFNAEAGTLRG
MHYQLPPAPEVKIVRCIRGALWDAIVDLRPDSPTYLQWYGVELTADNRLALYVPRGFAHG
FITLQAQTEALYFASAMYTPAAERGLRWDDARIGIRWPCTPALVSDKDAAWPEFNEQVHG
VTQLTGLTQQERA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatctttcgccccacgccgttgtctggcgccttcatcatcgagcccgaaccgcgaggc
gatgcgcgtggatggtttgcgcgggtgttctgtacccaggagatggcgcaggccgggctg
gtggaccagttcgtgcaggtcaacaattccttcaacgcagaggccggcaccttgcgcggc
atgcactatcagctgccgcccgcgccggaggtcaagatcgtgcgctgcatccgcggcgcg
ctgtgggatgccattgtcgacctgcgcccggattcgcccacctacctgcagtggtacggg
gtcgaactcactgccgacaaccgcctggcactgtatgtgccgcgcgggtttgcgcatggc
ttcatcacgctgcaggcgcagaccgaagcgctgtatttcgccagtgcgatgtatacgccg
gctgccgaacgcggactgcgctgggacgatgcgcgcattggcatccgctggccgtgcacg
cccgcattggtgtccgacaaggacgccgcctggccggagttcaatgagcaggtgcatggc
gtgacccaactgaccgggctgactcaacaggagcgcgcatga

DBGET integrated database retrieval system