KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC2137Help
Entry
XCC2137           CDS       T00083                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCC2137 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCC2137 (glk)
   00052 Galactose metabolism
    XCC2137 (glk)
   00500 Starch and sucrose metabolism
    XCC2137 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    XCC2137 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XCC2137 (glk)
   00524 Butirosin and neomycin biosynthesis
    XCC2137 (glk)
Enzymes [BR:xcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     XCC2137 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2521610..2522617
Genome map
AA seq 335 aa AA seqDB search
MTAPSKPVLVADIGGTNARFALADIDASVPLLDDTCREFAVVEFGSLGEAARYYLDQIGV
QATKGVFAVAGRVDGDEARITNHPWVISRSRTATMLGFSTLHLINDFAAQAMAISLLRPQ
DVVQVGGASWRPAPIELPRNYGVIGPGTGLGVGGLIIRNGRCFPLETEGGHVSFPPGTPE
EIRVLEILSEQFGRVSNERLICGPGLVNIHRALSEIAGIDPGPLEPKDITARAAAGDPRA
SRTIDLFCAIFGAIAGDMVLMQGAWDGVFLTGGLVPKVLDSLQHSGFRQRFEHKGRFSAI
MSRVPSLAVMHPHAGLLGAAAYAVDAERALPGEQR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgactgctccttccaagccggtgctggttgccgacatcggtggcaccaacgcgcgcttc
gcgctggccgacatcgatgcctcggtaccgctgctggacgacacctgccgtgagttcgcg
gtggtcgagttcggctcgctgggcgaggccgcgcgctattacctggaccagattggcgtg
caggccaccaagggcgtgttcgcggtggccggccgtgtggatggcgacgaagcccgcatc
accaaccatccgtgggtgatctcgcgctcgcgcaccgccaccatgctgggcttcagcacg
ctgcacctgatcaacgacttcgccgcgcaagcgatggcgatcagcctgctgcgcccgcag
gacgtggtgcaggtgggcggcgccagctggcgcccggcaccgatcgagctgccgcgcaac
tacggcgtcatcggcccgggcaccgggctgggcgtgggtggcctgatcatccgcaacggc
cgctgttttccgctggaaaccgaaggcggccatgtcagcttcccgcccggcacgccggaa
gagattcgcgtgctggagatcctgtccgagcagttcggccgggtctccaacgagcgcctg
atctgcggcccgggcctggtcaacatccaccgcgcgctgagcgagattgccggcatcgac
cccggcccgctggagcccaaggacatcaccgcacgtgccgccgctggcgacccgcgtgcc
tcgcgcaccattgatctgttctgcgccatcttcggcgcgatcgccggtgacatggtgctg
atgcagggtgcctgggacggcgtcttcctcaccggcgggctggtgcccaaggtgctggat
tcgctgcagcattccggcttccgccagcgcttcgaacacaagggccgtttctccgcaatc
atgtcgcgggtgccctcgctggcggtgatgcatccgcatgccggcctcctgggtgcagcg
gcgtatgcggtggacgccgaacgcgcattgccgggagagcagcgatga

DBGET integrated database retrieval system