KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC2188Help
Entry
XCC2188           CDS       T00083                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XCC2188 (galU)
   00052 Galactose metabolism
    XCC2188 (galU)
   00500 Starch and sucrose metabolism
    XCC2188 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    XCC2188 (galU)
Enzymes [BR:xcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     XCC2188 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2580789..2581682)
Genome map
AA seq 297 aa AA seqDB search
MSKRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNR
YKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPEGVRAIFVTQAEALGLGHAVMCAK
AVVGDEPFAVLLPDDLMWNRGDAALTQMADVAEASGGSVIAVEDVPHDKTASYGIVSTDA
FDGRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFEYLESTGAGAGGEIQLTDAIAEL
LKQEQVDAFRFEGRRFDCGAHIGLIEATVHFALEHEKHGAPAKEIIRSALAAADARG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcgtattcgcaaggccgtattccccgtcgcaggtcttgggacccgctttctt
ccggcaaccaagacggtgccgaaggaaatgctgccgatcatcgataaaccgcttatccag
tacgccgtggacgaagccatccaggccggttgcgatacgctgatcttcgtcaccaatcgc
tacaagcactcgatcgccgactacttcgacaaggcctatgagctggagcagaagctcgag
cgcgcaggcaagctcgagcaattggagctggtgcgccatgcactgcccgaaggcgtccgc
gccatttttgtgacgcaggccgaagcgctcggcctgggccatgcggtgatgtgtgccaag
gccgtggtcggtgacgaaccgttcgcagtgctgctgcccgacgacctgatgtggaaccgc
ggcgatgcggcgctgacccagatggccgatgtggcagaagcctccggcggcagcgtgatc
gccgtggaagatgtgccgcacgacaagacggccagttatggcatcgtgtccaccgatgcg
ttcgacggccgcaagggccgcatcaatgccatcgtcgaaaagcccaagccggaagtggcg
ccgagcaatctggcggtcgtcggtcgttacgtgctgagcccgaagatcttcgagtacctg
gagtccacgggcgccggtgcaggtggcgagatccagctcaccgatgcgatcgccgaactg
ctcaagcaggaacaggtcgatgcgttccgtttcgagggccgtcgcttcgactgcggcgcg
cacatcggtttgatcgaggccacggtgcactttgcgctcgagcacgagaagcatggcgca
ccggcgaaggaaatcattcgcagcgccttggccgcggcagacgcacgcggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system