KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC2188Help
Entry
XCC2188           CDS       T00083                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:xcc00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xcc00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xcc00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xcc00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2580789..2581682)
Genome map
AA seq 297 aa AA seqDB search
MSKRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNR
YKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPEGVRAIFVTQAEALGLGHAVMCAK
AVVGDEPFAVLLPDDLMWNRGDAALTQMADVAEASGGSVIAVEDVPHDKTASYGIVSTDA
FDGRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFEYLESTGAGAGGEIQLTDAIAEL
LKQEQVDAFRFEGRRFDCGAHIGLIEATVHFALEHEKHGAPAKEIIRSALAAADARG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcgtattcgcaaggccgtattccccgtcgcaggtcttgggacccgctttctt
ccggcaaccaagacggtgccgaaggaaatgctgccgatcatcgataaaccgcttatccag
tacgccgtggacgaagccatccaggccggttgcgatacgctgatcttcgtcaccaatcgc
tacaagcactcgatcgccgactacttcgacaaggcctatgagctggagcagaagctcgag
cgcgcaggcaagctcgagcaattggagctggtgcgccatgcactgcccgaaggcgtccgc
gccatttttgtgacgcaggccgaagcgctcggcctgggccatgcggtgatgtgtgccaag
gccgtggtcggtgacgaaccgttcgcagtgctgctgcccgacgacctgatgtggaaccgc
ggcgatgcggcgctgacccagatggccgatgtggcagaagcctccggcggcagcgtgatc
gccgtggaagatgtgccgcacgacaagacggccagttatggcatcgtgtccaccgatgcg
ttcgacggccgcaagggccgcatcaatgccatcgtcgaaaagcccaagccggaagtggcg
ccgagcaatctggcggtcgtcggtcgttacgtgctgagcccgaagatcttcgagtacctg
gagtccacgggcgccggtgcaggtggcgagatccagctcaccgatgcgatcgccgaactg
ctcaagcaggaacaggtcgatgcgttccgtttcgagggccgtcgcttcgactgcggcgcg
cacatcggtttgatcgaggccacggtgcactttgcgctcgagcacgagaagcatggcgca
ccggcgaaggaaatcattcgcagcgccttggccgcggcagacgcacgcggctga

DBGET integrated database retrieval system