KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC2239Help
Entry
XCC2239           CDS       T00083                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XCC2239 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    XCC2239 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    XCC2239 (proB)
Enzymes [BR:xcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     XCC2239 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2637910..2639064)
Genome map
AA seq 384 aa AA seqDB search
MTQPVVATSLFTEQVLPPWRRAVLKVGSSLLAADGGGLSPRFALGLAQFVSANLAAGREV
VIVSSGAVAAGRAILPKAAEAGAAIAARQALAALGQAQLIALWQRFFERPVAQVLLTHDD
LRNRRRYLNARATLGELLRLGALPVINENDTVSVDELKLGDNDNLAAIVAALVDADALFI
ATDIDGLYSADPRSNPLARPLDEVAELSAEVLAMAGGSGSSVGTGGMRTKLEAAAKAGAA
GIETYLFNGRSAEVVRGLAQDRLCGTRIHAARTRIAARKYWLRHAPVEPGTILIDAGAAL
ALTDKGASLLPGGVAGAEGDFRRGDMVEIHLRDSVGSRCLARGVSQYSALDVRRIARRHS
REIEPILGYSYGENVVHRDDLVVL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgacccagccggtcgtcgcgacctcgctgtttaccgagcaggtgctgccgccgtggcgg
cgcgcagtgctcaaggtcggcagcagcctgctggcggccgatggcggcggcctgtcgccg
cggtttgcgctgggcctggcgcagtttgtatcggccaatctggcggcggggcgcgaagtg
gtgatcgtctcgtccggcgcggtggcggccgggcgcgccatcctgcccaaggcagccgaa
gctggcgccgccatcgctgcgcgccaggcactggccgcgctgggccaggcgcagttgatc
gcgttgtggcagcgctttttcgagcgcccggtggcgcaggtgctgctcacccacgacgac
ctgcgcaaccgccgccgctacctcaatgcgcgcgccacgctgggcgaactgttgcggctg
ggcgcattgccggtgatcaacgagaacgacaccgtgtcggtggatgaactcaagctcggc
gacaacgacaacctggccgcgatcgtggccgcgctggtcgatgccgatgccttgttcatc
gccaccgatatcgatggcctgtacagcgccgacccgcgcagcaacccgctggcacgcccg
ctcgacgaggtggccgaactcagcgccgaggtgctggcgatggccggcggcagcggcagc
agcgtgggcaccggcggcatgcgcaccaagctggaagccgccgccaaggccggtgcggcc
gggatcgaaacctatctgttcaacggccgcagtgccgaggtggtgcgcgggctggcgcag
gaccggctgtgcggcacgcgcatccacgccgcgcgcacgcgcattgccgcgcgcaaatac
tggctgcggcatgcgccggtggagccgggcacgatcctgatcgacgccggcgccgcgctg
gcgctcaccgacaagggcgcctcgctgctacccggtggcgtggccggtgccgaaggcgat
ttccgccgtggcgacatggtggaaatccacctgcgcgacagcgtgggcagccgctgcctg
gcacgtggcgtgagccagtattcggcacttgatgtgcgccgcatcgcccgccgccattcg
cgcgagatcgaaccgatcctcggctacagctacggcgagaatgtggtgcatcgtgatgat
ctggtagttttgtag

DBGET integrated database retrieval system