KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC2265Help
Entry
XCC2265           CDS       T00083                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XCC2265
   00500 Starch and sucrose metabolism
    XCC2265
Enzymes [BR:xcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     XCC2265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2664457..2665662
Genome map
AA seq 401 aa AA seqDB search
MSASHIRTTCLATALLSLISLDAAALTGTASRPQLTSSEAGTYTISKALAKAGPITALVT
DNWNPTAGVALLTADFAVAADGSTRYRTVQSAIDAAVAAGGSTRRYISVKAGTYTELVCV
PSGAPPLTLFGLGSATTDTVIRYNNANPTPKPTGTASHPCASNASAATVGTSNSATVTVR
ASGFQARHLRFDNNYVEGTYADNNQSAVALAVRGDQASFEDVLVTGNQDTLLISATNAAN
VIRAYFKSSTIEGDVDFIFGSGIGVFDNAIIRSAGARLGSSRGGYIFAPSTRPGSGYGFL
AINSRFVAGSGSPDNQTYLGRAWDEGVSGLSAYVNGTSPNGQVTIRDSTLGSHIRKTAPW
NASTASRPFCSRNCTNSANRFFSNTATAVLAVPTDPGRSVR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcatcgcatatccgcaccacctgcctcgccaccgcgctgctgagcctgatcagc
cttgatgctgctgcccttaccggcaccgccagccgcccgcagctcaccagcagcgaagca
ggcacgtatacgatcagcaaggcgctcgccaaggccggcccgatcacagcgttggtgacc
gacaactggaaccccaccgccggcgtggcgctgctgaccgccgactttgcagttgccgcc
gacggctccacccgttatcgcacggtgcaatcggcaatcgacgcggcggtggccgccggt
ggcagcacgcgccgctacatcagcgtcaaggccggcacctacaccgagctggtgtgcgtg
ccgagcggtgcaccgccactgaccctgttcgggcttggcagcgccacgaccgacaccgtc
atccgctacaacaatgccaaccccacgcccaagccaaccggcaccgcaagtcacccctgc
gccagcaatgcgtcagccgccacagtgggcacttccaatagcgcgacggttaccgtacgt
gccagcggcttccaggcgcggcatctgcgcttcgacaataactatgtcgaaggcacttac
gccgacaacaatcaatcggcagtggcactggccgtgcgcggcgaccaggccagcttcgag
gacgtgctggtcaccggcaaccaggacaccttgctgatcagcgcgaccaacgccgccaac
gtgatccgcgcgtatttcaagagcagcacgatcgaaggcgatgtcgatttcatcttcggg
tccggcatcggcgtgttcgacaacgcaatcattcgctcggccggcgcgcgcctgggcagc
agccgtggtggctacatcttcgcgccaagcacgcgcccgggcagcggctacggctttctg
gcgatcaacagccgcttcgtagcgggctccggttcgccggacaatcaaacctacctcggg
cgcgcatgggacgaaggcgttagtggcctgtccgcgtacgtcaacggcacctcgcccaat
ggccaggtgaccatccgcgattccacgctgggcagccacatccgcaagaccgcgccatgg
aatgcctccaccgccagccgcccgttctgcagcaggaactgcaccaactcggccaaccgc
tttttttcgaatacggcaacagcggtgctggcagtgccgactgatccaggccgcagcgtt
cgatag

DBGET integrated database retrieval system