KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC2387Help
Entry
XCC2387           CDS       T00083                                 

Gene name
egl2
Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XCC2387 (egl2)
Enzymes [BR:xcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XCC2387 (egl2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2822923..2824683)
Genome map
AA seq 586 aa AA seqDB search
MTIFQTLLTAMVIASPIAACAADTTGTAGTTPAAGATIHVNQLGYLPGSAKLAVVGLPAS
AAAGPDRFTVEDAKGARVLEGSLSPAASWAPAGQQARVADFSALRTPGTYRLKIAGMPAS
DAFPIAASAYQPVVDASLKAFYYNRASTELPAQFAGRYARAAGHPDTEVRIHPSAASATR
PANSVISAPKGWYDAGDYNKYIVNSGISTYTVLAAYEHYPALFKAQALTIPNDAPGVPGI
LQEVWWNLEWMLAMQDPADGGVYHKLTDKQFDGLVMPDQAKQQRYVVMKATAATLDFAAV
MAAASRVYAPFDKQYPGASARMLKAARSAWAWAQQHPNVIYRQPDDVRTGGYDDATVDDE
FAWAAAELYVSTREDAFYDAMLARNVHASVPGWSNVGGLAWMSLAAHRDQLTPHADRARI
EGEISGLAQRLGDQWQASPWRLAMADNDFVWGSNAVVLNQAMMLLQGYRVTQQRRYLDAA
QSQLDYILGRNPLGLSFVTGVGQRTPMHIHHRPSEADGIDAPVPGWLAGGPQPGQQDAKD
CKVAYPSKLAALSYLDNTCSYATNEVAINWNAPLVYVSAAIEASTR
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaccattttccagaccctgctcaccgccatggtgatcgcatcgcccatcgccgcctgt
gcggcggacacgaccggcactgccggcaccacgccggccgctggcgccaccatccacgtc
aatcaactcggctatctgccgggctcggccaagctggcggtggtcggcttgccggcgtcc
gctgcggccggtccagaccgcttcacggtggaggatgccaagggcgctcgcgtgctggag
ggcagcttgtcgccggcggccagttgggcaccggcggggcaacaggcacgcgtggccgac
ttttccgcactgcgcacgccgggcacgtatcggttgaagatcgccggcatgccggcctcg
gatgcattcccgattgcagcgagtgcctaccagccggtcgtggatgcctcgctgaaggcg
ttctactacaaccgtgccagtaccgagttgccggcgcagtttgccgggcgctacgcgcgc
gcggccgggcatccggacaccgaggtgcgcatccatccgtcggcggcgtctgccacgcgc
ccggccaacagcgtgatcagcgcgcccaaggggtggtacgacgcgggcgactacaacaag
tacatcgtcaattccggcatcagcacctacaccgtgctggccgcgtatgagcactacccg
gcgctgttcaaggcgcaggcactcaccattcccaacgatgcgcctggcgtgcccggcatc
ctgcaggaagtgtggtggaatctggaatggatgctggccatgcaggacccggccgatggc
ggggtgtaccacaagctcaccgacaagcagttcgatgggctggtgatgccggaccaggcc
aagcagcagcgctatgtcgtgatgaaggccaccgccgccacgctggatttcgccgcggtg
atggcggcggccagccgcgtgtatgcgccgttcgacaagcagtatccaggcgcgtcggcg
cgcatgttgaaggcggcgcgtagtgcctgggcgtgggcgcaacaacacccgaacgtgatc
tatcgccagcctgacgacgtgcgtaccggcggctacgacgacgccaccgtagatgacgaa
tttgcctgggcagcagcggagctctatgtgagcacgcgcgaggacgcgttctacgacgcc
atgctggcgcgcaacgtacatgccagcgtgccggggtggagcaacgtgggtggattggcc
tggatgtcgttggccgcccaccgtgaccagctcacgccgcatgccgaccgcgcacgtatc
gaaggcgaaatcagcgggctggcgcagcgcctgggcgaccagtggcaggcatcgccgtgg
cgtttggccatggccgataatgactttgtctggggcagcaatgcggtggtactcaatcag
gccatgatgctgctgcagggctaccgggtgacgcagcaacgtcgttatctggatgcggcg
caatcgcagctggactacatcctggggcgcaatccgctggggctgtcgttcgtcaccggg
gtcgggcagcgcacgccaatgcatatccaccatcgcccatccgaagccgacggcatcgat
gcgcccgtgccgggctggctggccggtggcccgcagccgggccagcaggacgcgaaagac
tgcaaggtggcgtatccgtccaagctggccgcgctgtcgtatctggacaacacctgcagc
tacgcgacaaacgaggtagcgatcaactggaatgcgccgctggtgtatgtaagtgctgcg
atcgaggcgtcgacccgctga

DBGET integrated database retrieval system