KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC2465Help
Entry
XCC2465           CDS       T00083                                 

Gene name
cgt
Definition
cyclomaltodextrin glucanotransferase
Orthology
K00701  
cyclomaltodextrin glucanotransferase [EC:2.4.1.19]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Brite
Enzymes [BR:xcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.19  cyclomaltodextrin glucanotransferase
     XCC2465 (cgt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2927538..2929316)
Genome map
AA seq 592 aa AA seqDB search
MAGRATDLRAGDRRLEPDRGRCVRGAGPKRPGRAMMRSVLMAAMLLYSGAACAAPAPGDY
YGTLEPFAADAVYFVVTDRFVNGDTGNDHRDQGGAHRSFDVPTPCDGGVGDNIGYLGGDF
KGIVDHADYIRGLGFGAVWITPIVDNPDEAFTGGKPITCESTLSDHGKTGYHGYWGVNFY
RLDEHIPSPGLDFAGFTRSMHANDLKVVLDIVGNHGSPAYSMPVAQPGFGKLYDAQGRLV
ADHQNLAPAQLDPAHNPLHAFYNTSGGLAELSDLNEDNPAVLDYLAGAYLQWMEQGADAF
RIDTIGWMPDRFWHAFVARIREKRPGVFMFGEAFDYDPAKIAGHTWARNAGVSVLDFPLK
QQLSAVFGHKQAGFEQLATPLYLRKGPYGNPYELMSFYDNHDMARLDASDTGFIDAHNWL
FTARGIPVIYYGSETGFMRGRAEHAGNRNYFGEERVSNAPQSPIFGPLQRIATLRRNTPA
LQRGVQVDLQLRGDQAAFLRVYQHAGMTQTALVLLNKGDAAADIAVSRLLQPGSWRDAFS
GEQVQVQGRVTLQVPAHGVRVLLSDAPVTDVALRKQLDAQMADQAARDARNK
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtggctgggcgggcaaccgatctacgcgctggcgatcggcggcttgagcctgatcgtggc
cggtgtgtgcgtggtgcgggtcccaagcgcccagggagggcaatgatgcgcagcgtcttg
atggcagccatgctgctttattcgggagcagcctgcgctgcgcctgcacccggtgattac
tacggcaccctggaaccgttcgccgccgatgcggtgtatttcgtggtcaccgatcgcttc
gtcaacggcgacacgggcaacgatcaccgcgaccagggcggcgcacatcgcagcttcgat
gtgcccacaccgtgcgacggtggcgtgggcgacaacatcggttacctcggcggcgacttc
aagggcatcgtcgatcatgccgactacattcgcggcctcggctttggcgcggtgtggatc
accccgatcgtcgacaacccggacgaagcgttcaccggtggcaagcccatcacctgcgag
agcacgctcagcgatcacggcaagaccggttatcacggctattggggcgtcaatttttac
aggctcgacgaacatatccccagcccggggctggatttcgccgggttcacgcgctccatg
cacgccaatgacctgaaggtggtgctggatatcgtcggcaaccacggctcgcccgcctac
agcatgccggtggcgcagcccgggtttggcaagctctacgacgcacagggccgcctggtt
gccgatcatcagaacctcgcacccgcacagctcgacccggcgcacaacccgttgcacgcg
ttctacaacaccagcggcggcctggcggaattgtcggacctcaatgaagacaacccggct
gtgctggactatctagccggcgcctacctgcagtggatggagcagggtgccgatgcgttt
cgcatcgacaccatcggctggatgccagaccgcttctggcatgccttcgtagcgcggatc
cgcgagaaacgcccgggcgttttcatgtttggcgaagccttcgactacgacccggccaag
atcgccggccacacctgggcgcgcaacgccggcgtcagcgtgctggacttcccgctcaaa
cagcagctatccgccgtgttcggccacaaacaggctggcttcgaacagctcgccacgccg
ctgtatctgcgcaaaggcccgtatggcaacccgtacgagttgatgagcttctacgacaac
cacgacatggcgcgcctggatgccagcgataccggcttcatcgatgcgcacaattggttg
ttcaccgcgcgcggcattccggtgatctattacggctcggaaaccggcttcatgcgcggg
cgcgccgaacacgcgggtaatcgcaattattttggcgaagagcgcgtcagcaacgcaccg
cagagcccgatcttcggcccgctgcagcgcatcgcgaccttgcggcgcaataccccggcc
ctgcagcgcggcgtgcaggtggatctgcagttgcgcggcgaccaggcagcgttcctgcgc
gtctaccagcatgcgggcatgacgcagaccgcgttggtcttgctcaacaagggcgacgcg
gcggcggacattgcggtgtcccgcttgctgcagcccggcagctggcgcgacgccttcagt
ggcgagcaggtgcaggtgcaaggtcgcgtgacgctgcaggtgccggcgcatggcgtgcgc
gtgctgctgtcggatgcgccggtgaccgacgtcgccctacgcaagcagctggacgcacag
atggcggaccaggccgcgcgcgatgcacgcaacaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system