KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC2531Help
Entry
XCC2531           CDS       T00083                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00010  Glycolysis / Gluconeogenesis
xcc00051  Fructose and mannose metabolism
xcc00562  Inositol phosphate metabolism
xcc01100  Metabolic pathways
xcc01110  Biosynthesis of secondary metabolites
xcc01120  Microbial metabolism in diverse environments
xcc01130  Biosynthesis of antibiotics
xcc01200  Carbon metabolism
xcc01230  Biosynthesis of amino acids
Module
xcc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCC2531 (tpiA)
   00051 Fructose and mannose metabolism
    XCC2531 (tpiA)
   00562 Inositol phosphate metabolism
    XCC2531 (tpiA)
Enzymes [BR:xcc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XCC2531 (tpiA)
Exosome [BR:xcc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XCC2531 (tpiA)
  Exosomal proteins of bladder cancer cells
   XCC2531 (tpiA)
  Exosomal proteins of melanoma cells
   XCC2531 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 1002213
NCBI-ProteinID: NP_637879
UniProt: Q8P7T0
Position
complement(3003996..3004751)
Genome map
AA seq 251 aa AA seqDB search
MRRKIVAGNWKLHGTRAFATELVAQVAAHMPLAGVDVVILPPLPYLGDLIEDFEAHHLAF
GAQDVSSNEKGAYTGEVSASMLVDVGAEYGLVGHSERRQYHQESSELVARKFAAAMHAGL
IPVLCVGESLEQREAGQTEAILRAQLEPVLSLVGSAGFARAVVAYEPIWAIGTGRTATPD
QAQAVHAFIRGEVAKADARIADSLPILYGGSVKPDNASELFSQPDVDGGLVGGASLVAED
FLAIARAAAAC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgaaagatcgttgctggaaattggaagctgcatggcacgcgtgccttcgccacc
gaactggtggcgcaggtggccgcgcacatgcccctggcgggtgtcgatgtcgtcatcctg
ccgcccttgccgtatctcggtgatctgatcgaggacttcgaggcccaccacctggcattc
ggtgcacaggacgtcagtagcaacgagaagggcgcctacaccggtgaagtgtccgcctcg
atgctggtggatgtcggtgccgaatacggcctggtcgggcattcggagcgccgtcagtat
caccaggaaagtagcgagctggtcgcgcgcaagtttgccgccgcaatgcatgccgggttg
atcccggtgctgtgcgttggcgaatcgctggaacagcgcgaggcaggtcagactgaggca
atcctacgtgcccagttggagccggtcctgagcctggtcggcagtgccggattcgcccgc
gccgtggtggcctacgagccgatctgggccatcgggaccgggcgcaccgccacgccggac
caggcccaggccgtgcacgccttcattcgtggcgaagtcgcgaaggcggatgctagaatt
gccgattcactgcccatcctgtacggggggagtgtcaagcccgacaacgccagcgagctg
ttttcccagcccgacgtcgacggtgggctggtcggcggcgcatcactggttgccgaagac
ttcctggccattgcgcgtgcggcggccgcttgttaa

DBGET integrated database retrieval system