KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC2531Help
Entry
XCC2531           CDS       T00083                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCC2531 (tpiA)
   01230 Biosynthesis of amino acids
    XCC2531 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCC2531 (tpiA)
   00051 Fructose and mannose metabolism
    XCC2531 (tpiA)
   00562 Inositol phosphate metabolism
    XCC2531 (tpiA)
Enzymes [BR:xcc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XCC2531 (tpiA)
Exosome [BR:xcc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XCC2531 (tpiA)
  Exosomal proteins of bladder cancer cells
   XCC2531 (tpiA)
  Exosomal proteins of melanoma cells
   XCC2531 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3003996..3004751)
Genome map
AA seq 251 aa AA seqDB search
MRRKIVAGNWKLHGTRAFATELVAQVAAHMPLAGVDVVILPPLPYLGDLIEDFEAHHLAF
GAQDVSSNEKGAYTGEVSASMLVDVGAEYGLVGHSERRQYHQESSELVARKFAAAMHAGL
IPVLCVGESLEQREAGQTEAILRAQLEPVLSLVGSAGFARAVVAYEPIWAIGTGRTATPD
QAQAVHAFIRGEVAKADARIADSLPILYGGSVKPDNASELFSQPDVDGGLVGGASLVAED
FLAIARAAAAC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgaaagatcgttgctggaaattggaagctgcatggcacgcgtgccttcgccacc
gaactggtggcgcaggtggccgcgcacatgcccctggcgggtgtcgatgtcgtcatcctg
ccgcccttgccgtatctcggtgatctgatcgaggacttcgaggcccaccacctggcattc
ggtgcacaggacgtcagtagcaacgagaagggcgcctacaccggtgaagtgtccgcctcg
atgctggtggatgtcggtgccgaatacggcctggtcgggcattcggagcgccgtcagtat
caccaggaaagtagcgagctggtcgcgcgcaagtttgccgccgcaatgcatgccgggttg
atcccggtgctgtgcgttggcgaatcgctggaacagcgcgaggcaggtcagactgaggca
atcctacgtgcccagttggagccggtcctgagcctggtcggcagtgccggattcgcccgc
gccgtggtggcctacgagccgatctgggccatcgggaccgggcgcaccgccacgccggac
caggcccaggccgtgcacgccttcattcgtggcgaagtcgcgaaggcggatgctagaatt
gccgattcactgcccatcctgtacggggggagtgtcaagcccgacaacgccagcgagctg
ttttcccagcccgacgtcgacggtgggctggtcggcggcgcatcactggttgccgaagac
ttcctggccattgcgcgtgcggcggccgcttgttaa

DBGET integrated database retrieval system