KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC2541Help
Entry
XCC2541           CDS       T00083                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00260  Glycine, serine and threonine metabolism
xcc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xcc01100  Metabolic pathways
xcc01110  Biosynthesis of secondary metabolites
xcc01130  Biosynthesis of antibiotics
xcc01230  Biosynthesis of amino acids
Module
xcc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XCC2541 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XCC2541 (trpA)
Enzymes [BR:xcc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XCC2541 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB TMP-TENI DUF561
Motif
Other DBs
NCBI-GeneID: 999016
NCBI-ProteinID: NP_637889
UniProt: Q8P7S0
Position
complement(3015258..3016076)
Genome map
AA seq 272 aa AA seqDB search
MSRAPDRIAACFDALRHSGRKALIPFITAGDPSLEATVPVMHALVRAGANIIELGVPFSD
PMADGPTIQRSSERALGRGAGLAYVIEAVQEFRREDATTPVVLMGYLNPIEIHGTRRFAE
TAVAAGIDGVLLVDLPPEEADETRAIFTEVGLALIALASPTTGEARLDMLCSTAQGYLYY
VSFSGVTGAADRLDTHAASDRLRQLRARAGAPVVAGFGIKDAASAAAMAVDADGVVVGSA
LVAALADASDVRSARKRAEDFLQPLRQALDAG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgcgcccgaccgtatcgctgcgtgcttcgacgcgctgcgtcactccggccgc
aaggcgctgattcccttcatcaccgccggcgacccctcattggaagccaccgtgccggtg
atgcatgccctggtgcgcgctggtgcgaacatcatcgagctcggcgtgccgttctccgac
ccgatggccgacggccccaccatccagcgcagctccgagcgcgcgctgggccgcggtgcc
gggctggcctatgtgatcgaagccgtgcaggaattccggcgcgaggacgccaccaccccg
gtggtactgatgggctacctcaacccgatcgaaatccacggcacgcggcgctttgccgaa
accgcggtggccgccggcatcgatggcgtgctgctggtcgacctgccgcccgaggaggcc
gacgagacccgcgccatcttcaccgaggtcggtctggcgctgatcgccttggcgtcgccc
accaccggcgaggcccggctggacatgctgtgcagcactgcgcagggctatttgtattac
gtcagcttctctggcgtgactggcgcggccgaccggctggacacgcacgcggccagcgac
cgcctgcgccagctgcgcgcccgtgccggcgcacccgtggtggccggcttcggcatcaag
gacgccgccagtgctgccgcgatggcggtggatgcggacggcgtggtcgtcggcagcgcg
ctggtggcggccctggccgatgcgtcggatgtgcgcagcgcgcgtaagcgggccgaagac
ttcctgcagccgctgcggcaggcgctggacgccggctga

DBGET integrated database retrieval system