KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC2543Help
Entry
XCC2543           CDS       T00083                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XCC2543 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XCC2543 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XCC2543 (trpB)
Enzymes [BR:xcc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XCC2543 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3016588..3017805)
Genome map
AA seq 405 aa AA seqDB search
MSAQPISDFHAYPDAAGHFGKFGGRFVAETLIAPLQELSAAYDLARQDPAFIAEYDKDLK
HYVGRPSPIYHAERLSREVGGAQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIERQKINVYRMQLLGAKVIPVTSGSATLKDA
LNEAMRDWVSNVQDTFYIIGTVAGPDPYPRMVRDFNAIVGREARAQMLEDYGRLPDAISA
CVGGGSNAIGLFHAFLNDPGVKIYGAEAAGDGIASGRHAASIAAGRPGVLHGNRTYVICD
DDGQIIETHSVSAGLDYPGVGPEHAFLSDSGRAVYQGITDDEALAAFHLLAHTEGILAAL
ESSHAVAQSIKLAREMPKDALVLCNLSGRGDKDVHTIAAREGMVL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcccagcccatcagtgactttcatgcgtacccggatgccgccggccatttcggc
aagtttggcgggcgcttcgtcgcggaaaccttgatcgcgcccctgcaggaactgtctgcc
gcctacgatctggcgcgccaggatccggccttcattgccgagtacgacaaggatctcaaa
cattacgtcggccgccccagcccgatctaccacgccgagcggctgagccgcgaagtgggc
ggggcgcagatcctgctcaagcgcgaagacctgaaccacaccggcgcgcacaagatcaac
aacaccatcggccaggcgctgctggccagccgcatgggcaagacccgcatcattgccgag
accggcgccggccagcatggcgtggccagtgccaccgtcgcggcgcggctgggcctggaa
tgcgtggtctacatgggcgcgaccgacatcgaacggcagaagatcaacgtctaccgcatg
cagttgctcggtgcgaaggtcatcccagtcacctcgggctcggccacgctcaaggacgcg
ctgaatgaagcgatgcgcgactgggtcagcaacgtgcaggacaccttctacatcatcggc
accgtcgccggcccggatccgtatccgcgcatggtgcgcgatttcaacgccatcgtcggc
cgcgaagcgcgtgcgcagatgctggaagactacggccgcctgccggatgcgatcagcgcc
tgcgtgggcggcggcagcaacgccatcggtttgttccatgcgttcttgaacgaccccggc
gtcaagatctacggcgccgaagcggcgggtgatggcattgccagcggccgccatgcggca
tcgatcgccgccgggcgccccggcgtgctgcacggcaatcgcacgtatgtgatctgcgat
gacgacggccagatcatcgagacccattcggtctcggcgggcctggactacccaggcgtg
gggccggagcatgccttcctctccgacagcggccgtgccgtgtaccagggcatcaccgac
gacgaagcgctggccgcgttccacttgctggcgcataccgaaggcatcctggccgcgctg
gaatccagccatgcggtcgcgcagtcgatcaagcttgcgcgcgaaatgcccaaggacgcg
ctggtgctgtgcaacctgtccggccgtggcgacaaggacgtgcacaccatcgccgcacgc
gaaggcatggtgctgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system