KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC2712Help
Entry
XCC2712           CDS       T00083                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00010  Glycolysis / Gluconeogenesis
xcc00260  Glycine, serine and threonine metabolism
xcc00680  Methane metabolism
xcc01100  Metabolic pathways
xcc01110  Biosynthesis of secondary metabolites
xcc01120  Microbial metabolism in diverse environments
xcc01130  Biosynthesis of antibiotics
xcc01200  Carbon metabolism
xcc01230  Biosynthesis of amino acids
Module
xcc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCC2712 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    XCC2712 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XCC2712 (gpmA)
Enzymes [BR:xcc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     XCC2712 (gpmA)
Membrane trafficking [BR:xcc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    XCC2712 (gpmA)
Exosome [BR:xcc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   XCC2712 (gpmA)
  Exosomal proteins of melanoma cells
   XCC2712 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 999578
NCBI-ProteinID: NP_638060
UniProt: Q8P7A1
Position
complement(3216159..3216908)
Genome map
AA seq 249 aa AA seqDB search
MTRKLVLLRHGQSQWNLDNRFTGWVDVDLTEQGRQEAAAAGKLMKDEGLQFDVAYTSVLK
RAIHTLQGALKELDQDWLPVHKSWRLNERHYGGLQGLDKAETAAKHGEEQVKIWRRSYDI
PPPAMDVTDPGHPGHDRRYATLDRNALPGTESLATTLVRVLPYWHDAIAPQLKAGQTVLV
TAHGNSLRALYKYLNDISNAQILELNIPTGIPLLFELDDNLQVQSYRYLGDPEAAKRAAE
AVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcaaactcgtactgctgcgccatggccagagccaatggaacctggacaaccgt
ttcaccggctgggtggacgtggatctcaccgagcagggccgccaggaagccgccgcggcc
ggcaagctgatgaaggacgaagggctgcagttcgatgtggcgtacacctcggtgctcaag
cgcgccatccacacgctgcagggcgcgctgaaggagctcgaccaggactggctgccggtg
cacaagagctggcgcctcaatgagcgtcactacggtggcctgcagggcctggacaaggcc
gaaaccgcggccaagcacggcgaagagcaggtcaagatctggcgccgttcctacgacatc
ccgccgccggccatggacgtcaccgatccgggccatcccgggcatgaccgccgctatgcc
acgctggaccgcaatgcattgccgggcaccgagtcgctggcgaccacgctggtgcgcgtg
ttgccgtactggcacgacgcgatcgccccgcagttgaaggccggccagaccgtgctggtc
accgcgcacggcaactcgttgcgcgcgctgtacaagtacctcaacgacatctccaacgcg
cagatcctggagctcaacattcccaccggcatcccgctgttgttcgagctggacgacaac
ctgcaggtgcaaagctaccgctacctgggcgacccggaagcggccaagcgcgccgccgaa
gccgtggccaaccagggcaaggccaagtaa

DBGET integrated database retrieval system