KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC2822Help
Entry
XCC2822           CDS       T00083                                 

Gene name
cheB
Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XCC2822 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    XCC2822 (cheB)
Enzymes [BR:xcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     XCC2822 (cheB)
Two-component system [BR:xcc02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   XCC2822 (cheB)
Bacterial motility proteins [BR:xcc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    XCC2822 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3331149..3332180)
Genome map
AA seq 343 aa AA seqDB search
MVDNDLHPQQHRDVIVIGGSAGAGEALRRLLGALPAQTPAAILVVLHMSAHGHGIMRTVS
AGANGITVVEAADGMRIEPHTLYVAVADRHLMVADGRIVLGTGPRENMSRPSIDALFRSA
AVAFGPRTVGVLLSGMLNDGTAGLDAIHACGGTVLVQDPGEAVASDMPLSALQRVPADAV
RSSAELGGLIAELAQTAAGPARVITDALRLEVAIARGALTTTDDTARIATPVAMSCPACG
GVLSQISESSVLRFRCQVGHAYTGESLLSATEGSVDEALRIALRIIDERATLVARMADSN
TRAQPNTAAMYRHRADEYRGYADTLRKALLRKSPLAAAVEPSE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacaacgacctgcatccccagcagcaccgcgatgtcatcgtgatcggtggatcg
gctggcgccggcgaggcgttgcggcgcttgttgggtgcgctgccagcgcagacgcctgcc
gccatcctggtggtgctgcacatgtcggcgcatggtcacggcatcatgcgcacggtcagt
gccggtgccaacggcattaccgtggtcgaggccgccgatggcatgcgcatcgaaccgcac
acgctctatgtcgcggtggccgaccgtcacctgatggtggccgacgggcgaatcgtgctg
ggcaccggcccgcgcgaaaacatgtcgcggccttcgatcgatgccttgttccgctcggca
gcggtggccttcgggcccagaacggtgggggtgctgctatcggggatgctcaacgatggc
accgcaggtcttgacgcgattcacgcctgcggcggcacggtactggtgcaggatcctggc
gaggcggtggccagcgacatgccgctgagtgcgctgcagcgcgtgcctgccgatgccgtt
cgcagcagcgccgagttgggcggcctgattgcggaactggcgcagacagcggcagggccg
gcgcgggtgatcaccgatgccttgcgtctggaagtggcgatcgcacgcggtgcattgacc
acgaccgacgacaccgcgcggatcgccacgccggttgcgatgagttgcccggcatgtggc
ggcgtgctgtcgcaaatatcggagagttctgtgctgcggttccgctgccaggtcgggcat
gcctacacaggcgagagtctgctgtcggccaccgaagggtcggtggacgaggccctgcgc
attgccctgcgcatcatcgacgagcgggccaccttggtggcgcggatggccgattccaac
acccgtgcgcaaccgaataccgcagcgatgtaccgccatcgcgcggacgaataccgcggt
tatgcggacaccttgcgcaaggcgttgctgcgcaaatcgccgctcgctgcggcggtggaa
ccctcagagtga

DBGET integrated database retrieval system