KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC2822Help
Entry
XCC2822           CDS       T00083                                 

Gene name
cheB
Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:xcc02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:xcc02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3331149..3332180)
Genome map
AA seq 343 aa AA seqDB search
MVDNDLHPQQHRDVIVIGGSAGAGEALRRLLGALPAQTPAAILVVLHMSAHGHGIMRTVS
AGANGITVVEAADGMRIEPHTLYVAVADRHLMVADGRIVLGTGPRENMSRPSIDALFRSA
AVAFGPRTVGVLLSGMLNDGTAGLDAIHACGGTVLVQDPGEAVASDMPLSALQRVPADAV
RSSAELGGLIAELAQTAAGPARVITDALRLEVAIARGALTTTDDTARIATPVAMSCPACG
GVLSQISESSVLRFRCQVGHAYTGESLLSATEGSVDEALRIALRIIDERATLVARMADSN
TRAQPNTAAMYRHRADEYRGYADTLRKALLRKSPLAAAVEPSE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacaacgacctgcatccccagcagcaccgcgatgtcatcgtgatcggtggatcg
gctggcgccggcgaggcgttgcggcgcttgttgggtgcgctgccagcgcagacgcctgcc
gccatcctggtggtgctgcacatgtcggcgcatggtcacggcatcatgcgcacggtcagt
gccggtgccaacggcattaccgtggtcgaggccgccgatggcatgcgcatcgaaccgcac
acgctctatgtcgcggtggccgaccgtcacctgatggtggccgacgggcgaatcgtgctg
ggcaccggcccgcgcgaaaacatgtcgcggccttcgatcgatgccttgttccgctcggca
gcggtggccttcgggcccagaacggtgggggtgctgctatcggggatgctcaacgatggc
accgcaggtcttgacgcgattcacgcctgcggcggcacggtactggtgcaggatcctggc
gaggcggtggccagcgacatgccgctgagtgcgctgcagcgcgtgcctgccgatgccgtt
cgcagcagcgccgagttgggcggcctgattgcggaactggcgcagacagcggcagggccg
gcgcgggtgatcaccgatgccttgcgtctggaagtggcgatcgcacgcggtgcattgacc
acgaccgacgacaccgcgcggatcgccacgccggttgcgatgagttgcccggcatgtggc
ggcgtgctgtcgcaaatatcggagagttctgtgctgcggttccgctgccaggtcgggcat
gcctacacaggcgagagtctgctgtcggccaccgaagggtcggtggacgaggccctgcgc
attgccctgcgcatcatcgacgagcgggccaccttggtggcgcggatggccgattccaac
acccgtgcgcaaccgaataccgcagcgatgtaccgccatcgcgcggacgaataccgcggt
tatgcggacaccttgcgcaaggcgttgctgcgcaaatcgccgctcgctgcggcggtggaa
ccctcagagtga

DBGET integrated database retrieval system