KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC3181Help
Entry
XCC3181           CDS       T00083                                 

Gene name
cysG
Definition
siroheme synthase
Orthology
K02302  
uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:xcc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3779004..3780209
Genome map
AA seq 401 aa AA seqDB search
MTALFPLLADLRGRAVLVVGGGRAAESATASLLQAGAVPLVGAPELTPALRGWAQSGQVR
WLVGSFDPQWLALPDQPVWLTIAASDVPAVNAALRSVAGAQRLLTHEAAPAAAALPPIAS
EPPPPASRLTLTPGSVALVGAGPGDPGLLTRNAVRALRQAEVILYDRLVSPQILRLAQRA
ARCIEVGKSAQGHSTRQEQIHALMLEHARAGRRVVRLKGGDPFVFGRGGEELEFLHAHGI
GFQVVPGITAAVACAAYAGIPLTHRDHAQSLRLITAHCKDSLDTLDWHALGQERQTLAFY
MGVAGLDSIQQRLLQAGRAADTPFALVENGSRPEQRVVTGTLSQLAATARLHAVRSPALL
ILGDVAALSQSLHWFGAAPLTGQPAHSPIATPHAPTLAHAA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgactgccctgttcccgctccttgccgatctgcgtggccgtgccgtcctggtggtcggc
ggcggccgcgctgccgaaagcgccaccgccagcctgctgcaggccggcgcggtgccgctg
gtgggcgcgccggaactgacaccggcgttgcgcggctgggcgcagtccggtcaggtgcgc
tggctggtgggcagctttgacccgcagtggctggcgctgccggaccagccggtctggctg
accattgcggccagcgatgtgccggccgtgaacgctgccttgcgcagcgtcgccggcgca
caacggctgctgacccatgaggccgctcccgcagcggcagcattgccgcccatcgccagc
gaaccaccgccaccagcaagccgcctcaccctcacgcccggcagcgtggcgctggtcggt
gccggcccgggcgaccccggcctgctcacccgcaatgcggtgcgcgcgctgcggcaggcc
gaggtgatcctgtacgaccgcctggtcagcccgcagatcctgcgtctggcccagcgcgca
gcgcgctgcatcgaagtgggcaaatccgcccaaggccacagcacgcgccaggagcagatc
catgcgctgatgctcgaacatgcgcgcgccgggcggcgcgtggtgcgcctgaaaggtggc
gacccgttcgtgtttggccgcggcggcgaagagctcgaattcctgcacgcgcacggcatc
ggtttccaggtggtgcccggcatcactgccgcagtggcctgtgccgcctacgccggtatc
ccgctcacccaccgcgaccatgcgcaatcgctgcgcctgatcaccgcgcactgcaaggat
tcgctggacacgctggactggcacgcattgggccaggagcggcagacgctggccttctac
atgggcgtggccggcctggatagcatccagcagcgcctgctgcaggccggccgcgccgcg
gacacgccatttgcgctggtcgaaaatggctcgcgcccggaacagcgcgtggtcaccggc
accttgtcgcagctggccgccaccgcgcgcttgcatgcggtgcgctcgcccgcactgttg
atcctgggcgacgtcgccgcgctgtcgcagtcgctgcactggttcggcgccgcgccgctc
accggccagcccgcgcactcacccatcgcaacgccccacgcgcccacactcgcccacgca
gcctga

DBGET integrated database retrieval system