KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC3292Help
Entry
XCC3292           CDS       T00083                                 

Gene name
pfkA
Definition
(RefSeq) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00010  Glycolysis / Gluconeogenesis
xcc00030  Pentose phosphate pathway
xcc00051  Fructose and mannose metabolism
xcc00052  Galactose metabolism
xcc00680  Methane metabolism
xcc01100  Metabolic pathways
xcc01110  Biosynthesis of secondary metabolites
xcc01120  Microbial metabolism in diverse environments
xcc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCC3292 (pfkA)
   00030 Pentose phosphate pathway
    XCC3292 (pfkA)
   00051 Fructose and mannose metabolism
    XCC3292 (pfkA)
   00052 Galactose metabolism
    XCC3292 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    XCC3292 (pfkA)
Enzymes [BR:xcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     XCC3292 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     XCC3292 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 999470
NCBI-ProteinID: NP_638638
UniProt: Q8P5P4
Position
3908448..3909704
Genome map
AA seq 418 aa AA seqDB search
MTNGNLLYAQSGGVTAVINATAAGVIGEARARKIKVLAARNGILGALREELIDTSKESAA
AIAALAQTPGGAFGSCRYKLKSLEQDRAKYERLLEVLRAHDVRWFLYNGGNDSADTALKV
SQLAKAFGYPLHCIGVPKTIDNDLAVTDTCPGFGSAAKYTAVSVREAALDVAAMADTSTK
VFIYEAMGRHAGWLAAAAGLAGQGPDDAPQIILLPERAFDQPAFLAKVRQVVERVGWCVV
VASEGIQDAQGKFVADAGGATDSFGHAQLGGVASFLAAQVKQELGYKVHWTLPDYLQRSA
RHLASKTDWEQAQAVGKAAVQYALKGMNAVIPVIERVSDAPYRWKIVPAPLHKVANHEKK
MPPSFLRKDGFGLTERARRYFAPLIKGEAPLAYGSDGLPKYVTLKNVAVAKKLPAWEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacggcaacctgttgtatgcccagtccggcggtgtcactgccgtcatcaacgcc
accgctgccggggtgatcggcgaagcgcgcgcacgcaagatcaaggtgctggccgcacgc
aacggcatcctgggcgcactgcgcgaggaattgatcgacacctccaaggaatcggccgcg
gcgatcgccgcgctggcgcagacccccggcggcgcgttcggctcctgccgctacaagctc
aaatcgctggagcaggaccgcgccaaatacgagcgcctgctggaggtgctgcgcgcgcac
gacgtgcgctggttcctctacaacggcggcaacgactcggccgataccgcactgaaggtc
tcgcagctggccaaggcgttcggctacccgctgcactgcatcggcgtgcccaagaccatc
gacaacgacctggcggtgaccgacacctgccccggcttcggctcggccgccaagtacacc
gcggtctcggtgcgcgaagcggcgctggacgtggccgccatggccgacacctccaccaag
gtcttcatctacgaagcgatgggccgccacgccggctggctggccgccgccgcaggcctg
gccggccaaggcccggacgacgcgccgcagatcatcctgctgcccgagcgcgcctttgat
cagcccgcgttcctggccaaggtgcgccaggtggtggaacgggtcggctggtgcgtggtg
gtggccagcgagggcatccaggacgcacagggcaaattcgtcgccgatgccggtggcgcg
accgactcgttcggccacgcgcaactgggcggtgtggcctcgttcctcgcagcacaggtc
aaacaggaactcggctacaaggtgcactggacgctgcccgattacctacagcgttccgca
cgccacctcgcctccaagaccgactgggaacaagcccaggctgtgggcaaggccgccgtg
cagtacgcactcaagggcatgaacgcggtgatcccggtgatcgagcgcgtcagcgacgcc
ccctatcgctggaagatcgtgcccgccccgctgcacaaggtggccaaccacgaaaagaag
atgccacctagcttcctgcgcaaggacggcttcggcctcaccgaacgcgcccgccgctac
ttcgccccactgatcaagggcgaggccccgctggcctacggcagcgatggcctgccgaag
tatgtgacgttgaagaatgtggcggtggcgaagaaattgccggcttgggagggctga

DBGET integrated database retrieval system