KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC3292Help
Entry
XCC3292           CDS       T00083                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCC3292 (pfkA)
   01230 Biosynthesis of amino acids
    XCC3292 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCC3292 (pfkA)
   00030 Pentose phosphate pathway
    XCC3292 (pfkA)
   00051 Fructose and mannose metabolism
    XCC3292 (pfkA)
   00052 Galactose metabolism
    XCC3292 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    XCC3292 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    XCC3292 (pfkA)
Enzymes [BR:xcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     XCC3292 (pfkA)
Protein phosphatases and associated proteins [BR:xcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     XCC3292 (pfkA)
Messenger RNA biogenesis [BR:xcc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     XCC3292 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3908448..3909704
Genome map
AA seq 418 aa AA seqDB search
MTNGNLLYAQSGGVTAVINATAAGVIGEARARKIKVLAARNGILGALREELIDTSKESAA
AIAALAQTPGGAFGSCRYKLKSLEQDRAKYERLLEVLRAHDVRWFLYNGGNDSADTALKV
SQLAKAFGYPLHCIGVPKTIDNDLAVTDTCPGFGSAAKYTAVSVREAALDVAAMADTSTK
VFIYEAMGRHAGWLAAAAGLAGQGPDDAPQIILLPERAFDQPAFLAKVRQVVERVGWCVV
VASEGIQDAQGKFVADAGGATDSFGHAQLGGVASFLAAQVKQELGYKVHWTLPDYLQRSA
RHLASKTDWEQAQAVGKAAVQYALKGMNAVIPVIERVSDAPYRWKIVPAPLHKVANHEKK
MPPSFLRKDGFGLTERARRYFAPLIKGEAPLAYGSDGLPKYVTLKNVAVAKKLPAWEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacggcaacctgttgtatgcccagtccggcggtgtcactgccgtcatcaacgcc
accgctgccggggtgatcggcgaagcgcgcgcacgcaagatcaaggtgctggccgcacgc
aacggcatcctgggcgcactgcgcgaggaattgatcgacacctccaaggaatcggccgcg
gcgatcgccgcgctggcgcagacccccggcggcgcgttcggctcctgccgctacaagctc
aaatcgctggagcaggaccgcgccaaatacgagcgcctgctggaggtgctgcgcgcgcac
gacgtgcgctggttcctctacaacggcggcaacgactcggccgataccgcactgaaggtc
tcgcagctggccaaggcgttcggctacccgctgcactgcatcggcgtgcccaagaccatc
gacaacgacctggcggtgaccgacacctgccccggcttcggctcggccgccaagtacacc
gcggtctcggtgcgcgaagcggcgctggacgtggccgccatggccgacacctccaccaag
gtcttcatctacgaagcgatgggccgccacgccggctggctggccgccgccgcaggcctg
gccggccaaggcccggacgacgcgccgcagatcatcctgctgcccgagcgcgcctttgat
cagcccgcgttcctggccaaggtgcgccaggtggtggaacgggtcggctggtgcgtggtg
gtggccagcgagggcatccaggacgcacagggcaaattcgtcgccgatgccggtggcgcg
accgactcgttcggccacgcgcaactgggcggtgtggcctcgttcctcgcagcacaggtc
aaacaggaactcggctacaaggtgcactggacgctgcccgattacctacagcgttccgca
cgccacctcgcctccaagaccgactgggaacaagcccaggctgtgggcaaggccgccgtg
cagtacgcactcaagggcatgaacgcggtgatcccggtgatcgagcgcgtcagcgacgcc
ccctatcgctggaagatcgtgcccgccccgctgcacaaggtggccaaccacgaaaagaag
atgccacctagcttcctgcgcaaggacggcttcggcctcaccgaacgcgcccgccgctac
ttcgccccactgatcaagggcgaggccccgctggcctacggcagcgatggcctgccgaag
tatgtgacgttgaagaatgtggcggtggcgaagaaattgccggcttgggagggctga

DBGET integrated database retrieval system