KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC3857Help
Entry
XCC3857           CDS       T00083                                 

Gene name
algC
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCC3857 (algC)
   00030 Pentose phosphate pathway
    XCC3857 (algC)
   00051 Fructose and mannose metabolism
    XCC3857 (algC)
   00052 Galactose metabolism
    XCC3857 (algC)
   00500 Starch and sucrose metabolism
    XCC3857 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    XCC3857 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    XCC3857 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XCC3857 (algC)
Enzymes [BR:xcc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XCC3857 (algC)
    5.4.2.8  phosphomannomutase
     XCC3857 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4578219..4579613)
Genome map
AA seq 464 aa AA seqDB search
MQVAAEMFRAYDIRGVVGKDLNPGIAALIGQAIGSVMQAQGLRDIVVGRDGRLSGPELTN
GLIEGLRRAGCNVTDIGLAPTPVVYFGAYELRAGSCVAVTGSHNPPDYNGFKIVIGGETL
SGAAITELHQRITEGRLHTAASPGELEQRDISDAYIQRIADDVQLDRPIKVVVDAGNGAA
GEIAPRLLEAIGAEVVPLYCEIDGTFPNHHPDPSEPHNLGDLVQMVQRFDADIGVAFDGD
ADRLGVVTKEGAIVFPDRLLMLFAADVLQRNPGALVIYDVKCTGKLSDYVLRNGGSPLMW
KTGHSLIKAKMRETDAELAGEMSGHFFFKERWYGFDDGIYAAARLLEILAQREETPSDVL
GELPESVSTPEIKVPLDGDAHALVARFVERAQAGEESPFEAARLSTIDGLRADFGDGWGL
VRASNTTPILVLRFEADTAVALERIRALFRSELQALLPDHPLAF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggtcgccgcagaaatgttccgcgcgtacgacatccgtggcgtggtgggcaaggat
ctcaaccccggcatcgccgcgctgatcggccaggccatcggcagcgtgatgcaggcgcaa
ggcctgcgcgacatcgtggttggccgcgatggccgtttgtctggcccggaattgaccaac
ggcctgatcgaaggcctgcgccgcgccggttgcaacgtcaccgacatcggcctggcgccg
acgccggtggtgtacttcggcgcctacgaattgcgcgccggcagctgcgtggcggtgacc
ggcagccacaatccgcccgactacaacggcttcaagatcgtgatcggcggcgagacgctc
tccggtgcagcgatcaccgagctgcaccagcgcatcaccgaaggccgcctgcataccgca
gccagccccggcgaactggagcagcgcgacatcagcgatgcctacatccagcgcattgcc
gacgacgtgcagctggaccgcccgatcaaggtggtggtggacgccggtaatggcgcggcc
ggcgagatcgcgccgcgcttgttggaggccatcggtgcggaagtggtgccgctgtattgc
gaaatcgacggcacttttcccaatcaccatccagacccgagcgagccgcacaatctcggc
gatctggtgcagatggtgcagcgcttcgatgcggatatcggcgtggccttcgatggcgat
gccgaccgcctgggcgtggtcaccaaggaaggcgccatcgtcttccccgaccgcctgctg
atgctgtttgccgccgatgtgctgcaacgcaatcccggcgcgctggtgatctacgacgtg
aagtgcaccggcaagctgtccgactacgtgttgcgcaatggcggcagcccgttgatgtgg
aagaccgggcattcgctgatcaaggcgaagatgcgcgaaaccgatgccgagctggccggt
gaaatgagcgggcacttcttcttcaaggagcgctggtacggcttcgacgatggcatctat
gccgccgcgcgcctgctggaaatcctcgcccagcgcgaagagaccccgtccgacgtgctc
ggcgagctgcccgaaagcgtgtccacgccggagatcaaggtaccgttggacggcgatgcg
catgcgctggtggcccggttcgtggagcgtgcccaggccggcgaggagtcgccgttcgag
gccgcgcggttgtccaccatcgatgggctgcgcgcggatttcggcgacggctggggcctg
gtacgtgcgtccaacaccaccccgatcctggtgctgcgcttcgaagccgacaccgctgtg
gcgctggaacgcatccgcgcgctgttccgcagcgaactgcaggcgctgctgccggatcac
ccgctcgcattctga

DBGET integrated database retrieval system