KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC3926Help
Entry
XCC3926           CDS       T00083                                 

Gene name
argI
Definition
(RefSeq) arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XCC3926 (argI)
  Amino acid metabolism
   00220 Arginine biosynthesis
    XCC3926 (argI)
   00330 Arginine and proline metabolism
    XCC3926 (argI)
Enzymes [BR:xcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     XCC3926 (argI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4656732..4657655)
Genome map
AA seq 307 aa AA seqDB search
MATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLQEALVGRGVEVRDLGNLDGPRNPW
QAPQAGYRHLDEVVAWNQALMDASYAQLCAGRMPVMLGGDHCLGIGSITAVAKYCREQHR
PLRVLWLDAHSDFNTSEVTPSGNVHGMPVACLCGLGPQALTHLGGSAPAVLPEQIRQIGI
RSVDPDEKRLIKQHRIDVYDMRYIDEAGMKRTMEAALQGMSADTHLHVSFDVDFLDPSIA
PGVGTTVPGGPNYREAQLVMEMIADTGRMGSLDIVELNPVLDNRNATAELAVDLVESLFG
KSTLMRD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcagtacgtgccggtttccctgattggcgtgcccaccgacatcggtgccggc
caccgtggtgcccggatggggccggaggcattgcgcatcgccgggctgcaggaggccttg
gtcgggcgcggcgtcgaggtgcgtgacctgggcaatctggatggcccgcgcaatccgtgg
caggcaccgcaggccgggtaccggcatctggacgaggtggtggcctggaaccaggcgttg
atggacgccagctacgcacagctgtgcgcaggccgcatgcccgtcatgctgggcggcgac
cattgcctgggcatcggttcgatcaccgcggtggccaagtactgccgcgagcagcatcgc
ccgctgcgggtgctgtggctggatgcgcattcggacttcaataccagcgaggtaaccccg
tccggtaacgtgcacggcatgccggtggcctgcctgtgcggccttggcccgcaggcgctg
acccacctgggcggcagcgcgcccgccgtgttgcccgagcagatccggcagatcggcatc
cgctcggtggacccggacgagaagcgcctgatcaagcagcaccgcatcgacgtctacgac
atgcgctacatcgacgaagccggcatgaagcgcaccatggaagcggccctgcaaggcatg
agcgccgatacccacctgcatgtgagcttcgatgtggacttcctggaccccagcattgcg
ccgggcgtaggcaccaccgtgccgggtgggccgaactaccgcgaggcccagctggtgatg
gagatgatcgccgacaccgggcgaatggggtcgctggatatcgtggagctcaatccggtg
ctagacaaccgcaacgccaccgccgagctggcggtggatctggtggaaagcctgttcggc
aagtcgacgctgatgcgagattga

DBGET integrated database retrieval system