KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC3926Help
Entry
XCC3926           CDS       T00083                                 

Gene name
argI
Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00220  Arginine biosynthesis
xcc00330  Arginine and proline metabolism
xcc01100  Metabolic pathways
xcc01110  Biosynthesis of secondary metabolites
xcc01130  Biosynthesis of antibiotics
xcc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    XCC3926 (argI)
   00330 Arginine and proline metabolism
    XCC3926 (argI)
Enzymes [BR:xcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     XCC3926 (argI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 1000605
NCBI-ProteinID: NP_639266
UniProt: Q8P3Z1
Position
complement(4656732..4657655)
Genome map
AA seq 307 aa AA seqDB search
MATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLQEALVGRGVEVRDLGNLDGPRNPW
QAPQAGYRHLDEVVAWNQALMDASYAQLCAGRMPVMLGGDHCLGIGSITAVAKYCREQHR
PLRVLWLDAHSDFNTSEVTPSGNVHGMPVACLCGLGPQALTHLGGSAPAVLPEQIRQIGI
RSVDPDEKRLIKQHRIDVYDMRYIDEAGMKRTMEAALQGMSADTHLHVSFDVDFLDPSIA
PGVGTTVPGGPNYREAQLVMEMIADTGRMGSLDIVELNPVLDNRNATAELAVDLVESLFG
KSTLMRD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcagtacgtgccggtttccctgattggcgtgcccaccgacatcggtgccggc
caccgtggtgcccggatggggccggaggcattgcgcatcgccgggctgcaggaggccttg
gtcgggcgcggcgtcgaggtgcgtgacctgggcaatctggatggcccgcgcaatccgtgg
caggcaccgcaggccgggtaccggcatctggacgaggtggtggcctggaaccaggcgttg
atggacgccagctacgcacagctgtgcgcaggccgcatgcccgtcatgctgggcggcgac
cattgcctgggcatcggttcgatcaccgcggtggccaagtactgccgcgagcagcatcgc
ccgctgcgggtgctgtggctggatgcgcattcggacttcaataccagcgaggtaaccccg
tccggtaacgtgcacggcatgccggtggcctgcctgtgcggccttggcccgcaggcgctg
acccacctgggcggcagcgcgcccgccgtgttgcccgagcagatccggcagatcggcatc
cgctcggtggacccggacgagaagcgcctgatcaagcagcaccgcatcgacgtctacgac
atgcgctacatcgacgaagccggcatgaagcgcaccatggaagcggccctgcaaggcatg
agcgccgatacccacctgcatgtgagcttcgatgtggacttcctggaccccagcattgcg
ccgggcgtaggcaccaccgtgccgggtgggccgaactaccgcgaggcccagctggtgatg
gagatgatcgccgacaccgggcgaatggggtcgctggatatcgtggagctcaatccggtg
ctagacaaccgcaacgccaccgccgagctggcggtggatctggtggaaagcctgttcggc
aagtcgacgctgatgcgagattga

DBGET integrated database retrieval system