KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC4046Help
Entry
XCC4046           CDS       T00083                                 

Gene name
xthA1
Definition
exodeoxyribonuclease III
Orthology
K01142  
exodeoxyribonuclease III [EC:3.1.11.2]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    XCC4046 (xthA1)
Enzymes [BR:xcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     XCC4046 (xthA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4798378..4799157)
Genome map
AA seq 259 aa AA seqDB search
MKIASWNVNSLNVRLPHLQQWLADFAPDVVGIQETKLEDHKFPDAALAALGYRSVFCGQK
TYNGVAILSRSPALEVQMGIPGFDDVQQRVIAATVDGVRIINLYVVNGQDVGTDKYAYKL
RWLEAVHDWIAQELQRHPQLVVLGDFNIAPDARDVYEPEVWSDNHILTSTAERGALHKLL
ALGLHDAFRLHHDDAGHFSWWDYRQAAYRRNLGLRIDLTLVSDALRARAVEAGIDREPRT
WERPSDHAPAWVRLAEAGA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgcctcctggaacgtcaactcgctcaacgtgcgcctgccgcacctgcaacag
tggctggcggattttgcgccggacgtggtgggcatccaggaaaccaagctggaagaccac
aagttcccggatgcggcactggccgcgctgggctaccgcagcgtgttctgcgggcagaag
acctacaacggcgtggcaatcctgtcgcgctcgccggcgctggaggtgcagatgggcatc
cccgggttcgatgacgtgcagcagcgcgtcatcgccgccaccgtcgatggtgtgcgcatc
atcaatctgtatgtggtcaacggccaggacgtgggcaccgacaagtacgcctacaagctg
cgctggctcgaggcggtgcacgactggatcgcgcaggagctgcagcgccacccgcagctg
gtggtgctgggcgacttcaacatcgccccggacgcgcgcgacgtgtacgagccggaggtg
tggagcgacaaccacatcctcacttccaccgccgagcgcggcgccctgcacaagctgctg
gcgctgggcctgcacgatgcttttcgcctgcatcacgacgatgccggccacttcagttgg
tgggattaccgccaggccgcctaccgccgcaacctggggctgcgcatcgacctgacgttg
gtgtcggatgcgctgcgcgcccgcgcggtggaagcgggcatcgaccgcgaaccacgcacc
tgggagcgccccagcgaccacgcaccggcgtgggtgcggttggccgaggcaggcgcatga

DBGET integrated database retrieval system