KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC4060Help
Entry
XCC4060           CDS       T00083                                 

Gene name
acs
Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00010  Glycolysis / Gluconeogenesis
xcc00620  Pyruvate metabolism
xcc00640  Propanoate metabolism
xcc00680  Methane metabolism
xcc01100  Metabolic pathways
xcc01110  Biosynthesis of secondary metabolites
xcc01120  Microbial metabolism in diverse environments
xcc01130  Biosynthesis of antibiotics
xcc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCC4060 (acs)
   00620 Pyruvate metabolism
    XCC4060 (acs)
   00640 Propanoate metabolism
    XCC4060 (acs)
  Energy metabolism
   00680 Methane metabolism
    XCC4060 (acs)
Enzymes [BR:xcc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     XCC4060 (acs)
Lipid biosynthesis proteins [BR:xcc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   XCC4060 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 1000815
NCBI-ProteinID: NP_639399
UniProt: Q8P3L1
Position
4816878..4818821
Genome map
AA seq 647 aa AA seqDB search
MADVYPVDPAFAADARITREQYATLYRESIEHPEQFWGKAAQRLDWFKQPTQIKDVSFAL
DDFHVRWFGDGELNASVNCLDRQLATRGDKTALLFEPDSPDSPSYPVTYRELYERVCKLG
NALRNLGVKKGDRVTIYLPMIVDAAVAMLACARIGAVHSVVFGGFAANSIADRVIDCQSK
LIITADEGLRGGKKIPLKANVDAALKIPGTNTVETVLVVRHTGGAVDMQAPRDRWFHDVV
DGQPAECEPERMNAEDPLFILYTSGSTGKPKGVLHTTAGYLLFASYTHEVVFDLREDDIY
WCTADVGWVTGHSYIVYGPLANGATAVMFEGVPNYPNVSRFWEVIDKHQVTIFYTAPTAI
RALMREGEAPVKKTSRSSLRLLGSVGEPINPEAWRWYYEVVGDSRCPIVDTWWQTETGGI
LISPLAGAVDLKPGSATLPFFGVQPALVDAEGKILEGATEGNLVLLDSWPGQMRTVYGDH
QRFIDTYFRTYPGSYFTGDGCRRDADGYYWITGRVDDVINVSGHRIGTAEVESALVSHPK
VAEAAVVGFPHDVKGQGIYAYVTLIAGETPSEELHKELVSWVRKEIGPIASPDHLQWAPG
LPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPSVVDSLVNERLTR
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgtttatcccgtcgatcccgcgttcgccgctgatgcgcgcattacgcgcgag
cagtacgcaacgctgtaccgcgaatcgatcgaacaccccgagcagttctggggcaaggcc
gcgcagcggctggactggttcaagcaacccacccagatcaaggacgtcagcttcgcgctg
gacgacttccacgtgcgctggttcggcgacggcgaactcaatgccagcgtcaactgcctg
gaccgccagctggccacccgcggcgacaagaccgcgctgctgttcgaacccgacagcccg
gattcgccgtcctacccggtcacctaccgcgagctctatgagcgcgtgtgcaagctgggc
aacgcgctgcgcaacctgggcgtcaagaagggcgaccgggtcaccatctatctgccgatg
atcgtcgatgcggccgtggcgatgctcgcctgcgcgcgcatcggtgcggtgcactcggtg
gtgtttggcggctttgcggccaactccatcgccgaccgcgtgatcgactgccagagcaag
ctgatcatcaccgccgacgaaggcctgcgcggcggcaagaagatcccgctcaaggcgaac
gtggacgcggcgctgaagatccccggcaccaacacggtcgaaaccgtgctggtggtgcgc
cacaccggcggtgcagtggacatgcaggccccgcgcgaccgctggttccatgacgtggtc
gatggccagccggccgagtgcgaacccgagcgcatgaacgcggaagacccgttgttcatc
ctctacacctccgggtccacaggcaagcccaagggcgtgctgcacaccaccgccggctac
ctgctgtttgccagctatacgcatgaagtggtgttcgacctgcgcgaggacgacatctac
tggtgcaccgccgacgtgggctgggttaccggccacagctacatcgtctacggcccgctg
gccaacggcgccaccgcggtgatgttcgaaggcgtgccgaattaccccaacgtctcgcgt
ttctgggaagtgatcgacaagcaccaggtcaccatcttctacaccgcgcccaccgccatc
cgcgcgctgatgcgcgaaggcgaagcaccggtcaagaagacctcgcgcagcagcctgcgc
ctgctcggcagcgttggcgagccgatcaatcccgaagcctggcgctggtactacgaggtg
gtcggcgacagccgttgcccgatcgtggacacctggtggcagaccgaaaccggcggcatc
ctgatctcgccgctggccggcgcggtggacctcaagcccggctcggccaccctgccgttc
ttcggcgtgcagccggccctggtcgatgccgaaggcaagatcctggaaggcgccaccgag
ggcaacctggtgctgctggattcgtggccgggccagatgcgcaccgtctacggcgaccac
cagcgcttcatcgacacctacttccgcacctacccgggtagctacttcaccggtgacggc
tgccgccgcgacgccgatggctactactggatcaccggccgcgtggacgacgtgatcaac
gtctccggccaccgcatcggcaccgccgaggtggaaagcgcgttggtgtcgcacccgaag
gtggccgaagcggccgtggtcggcttcccgcacgacgtcaagggccagggcatctacgcc
tacgtgaccctgatcgccggcgagacgcccagcgaagagctgcacaaggaactggtgagc
tgggtgcgcaaggagatcggcccgatcgcctcgccggaccatctgcaatgggccccgggc
ctgccgaagacccgctcgggcaagatcatgcgccgcatcctgcgcaagatcgccgaaaac
gccccggatcagctgggcgatacctccacgctggccgatccatcggtggtggattcgctg
gtcaatgagcggctgacgcgctga

DBGET integrated database retrieval system