KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC4100Help
Entry
XCC4100           CDS       T00083                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XCC4100 (xylA)
   00051 Fructose and mannose metabolism
    XCC4100 (xylA)
Enzymes [BR:xcc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     XCC4100 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4872854..4874194
Genome map
AA seq 446 aa AA seqDB search
MSNTVFIGAKEYFPGIGKIGFEGRDSDNPLAFKVYDANKQVAGKTMAEHLRFAVAYWHSF
CGNGADPFGPGTRAYPWDVGNTALARAEAKSDAAFEFFTKLGVPYYCFHDIDLAPDADDI
GEYENNLKHMVGIAKQRQADTGVKLLWGTANLFSHPRYMNGASTNPDFNVVARAAVQVKA
AIDATVELGGENYVFWGGREGYACLHNTQMKREQDNMARFLTLARDYGRAIGFKGNFLIE
PKPMEPMKHQYDFDSATVIGFLRQHGLDQDFKLNIEANHATLSGHSFEHDLQVASDAGLL
GSIDANRGNPQNGWDTDQFPTDLYDTVGAMLVVLRQGGLAPGGLNFDAKVRRESSDPQDL
FLAHIGGMDAFARGLEVADALLTSSPLETWRAQRYASFDSGAGADFANGTSTLADLATYA
AGKGEPTQLSGRQEAYENLINQYLTR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaccgttttcatcggcgcgaaagaatatttccccggcatcggcaagatcggc
ttcgaaggccgcgattcggacaacccgcttgcgttcaaggtgtacgacgccaacaagcag
gtcgccggcaagaccatggccgagcacctgcgctttgcagtggcttactggcacagcttc
tgcggcaatggcgccgatccgttcggcccgggcacgcgtgcgtatccgtgggatgtgggc
aacaccgcgctggcgcgtgccgaagccaagtccgatgccgcgttcgaattcttcaccaag
ctcggtgtgccgtactactgcttccacgacatcgatctggcgccggatgcggacgacatc
ggcgagtacgaaaacaacctcaagcacatggtgggcatcgccaagcagcgccaggccgac
accggcgtcaagttgctgtggggcaccgccaacctgttctcgcacccgcgctacatgaat
ggtgcgtccaccaatccggacttcaacgtcgtagcgcgcgccgcggtgcaggtcaaggct
gcgatcgatgccacggtggagctgggcggcgagaactacgtattctggggcggtcgcgaa
ggctacgcctgcctgcacaacacgcagatgaagcgcgagcaggacaacatggcgcgcttc
ctcaccctggcacgcgactacgggcgtgcgatcggcttcaaaggcaacttcctgatcgag
cccaagcccatggagccgatgaagcaccagtacgatttcgacagcgccacggtgatcggc
ttcctgcgccagcacggcctggaccaggatttcaagctcaatatcgaagccaaccacgcc
acgctgtcgggtcacagcttcgagcacgacctgcaggtggccagcgatgccggcctgctt
ggcagcatcgatgccaaccgcggcaacccgcaaaacggctgggataccgaccagttcccg
accgacctgtacgacaccgtcggcgcgatgctggtggtgctgcgtcagggcgggctggca
ccgggcgggctgaacttcgatgccaaggtgcggcgtgaatcatccgacccgcaggacctg
ttcctggcccacatcggcggcatggacgcgttcgcacgcgggctggaagtggccgacgcg
ctgctgacctcttcgccgctggaaacctggcgcgcgcagcgttatgccagcttcgacagc
ggcgcgggcgcggactttgcgaacggcaccagcacgttggcggacctggccacgtacgcc
gccggcaagggcgagccgacgcagctcagcggccgccaggaagcctacgagaacctgatc
aatcagtacctgacgcgttga

DBGET integrated database retrieval system