KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC4116Help
Entry
XCC4116           CDS       T00083                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xcc00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:xcc00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:xcc00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4896462..4899164)
Genome map
AA seq 900 aa AA seqDB search
MALICLCTTAGVVTAAEPTNAPRERISLNADWRFRRGDPPGNTVRLEYDVRPEVVRSEDG
KVADARPEQAQRIDADARNVLKPWILPTANSLIADPTQRHVRPPGHPGSAVAYVQPMFDD
SAWQRVDLPHDWAIAGPFLADGPHGGMGRLPSWGVGWYRKALQIPASDRGRSLFLDLDGA
MSYATVWLNGKLVGGWPYGYTSWRVDLTPYVVPGGHNQLTIRLDNPPDSARWYPGGGLYR
NVWLTKTGPLRVAQWGTQLSTPQVSAERAQVQLAVQLDNAGAAPVQAQVSTALYALDDAS
GLRRGPAVAQIAAVQVQVAAGGNARVQGSTQIEAPRRWGPPPTQQPHRYVAVTEVSQGGR
VVDRVETPFGVRSVVFDPDKGLVINGEHVPIRGVNNHHDLGALGAAFNVRAAERQLQLLQ
HMGANAIRMSHNPPAPELLELTDRMGLLVVDEVFDSWEMKKTPLDFHLIFPQWHEPDLRA
MLRRDRNHPSIILWSVGNEVGEQYTGEAGAAIARRLHAIVYAEDPTRPATAAMNYASPEM
PLPAALDVISLNYQGEGIRDTPEFEGTERIRKPPQYPAFHAKFPRKAILSSETASALSSR
GVYLFPVSAQSSAPVRDGRGGDSVAHQVSAYELHAVDFGSSADKVFAALDRHPFVAGEFV
WTGFDYLGEPTPYYSSRSSYSGILDLAGFPKDRYWLYQARWRPELPMAHLLPHWSWPGRE
GQVTPVHVFTSGDEAELFVNGVSQGRKRKAPLQYRLRWDAVVYQPGELRVQAYKHGRPWA
SDRVQTAGRATRMQLSADRNQIRGDGKDLSFITVRLLDADGRPAPTAGDRLRFRVEGAGE
LVATDNGDPTNLEAFVLPERNAFNGLCLVIVRAKPGAQGPITVHVQSDTLQSASVQVLAE
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgatctgcctctgcactaccgcaggtgtggtcacagcggcggagccaaccaac
gcgccgcgcgaacggatctcgctcaacgccgactggcgcttccgccgtggcgacccgcct
ggcaataccgtgcggctggagtacgacgtacgcccggaggtggttcgcagcgaagacggc
aaggtggccgatgcgcggcccgagcaggcgcaacgcatcgacgccgacgcgcgcaacgtg
ctcaaaccgtggatcctgccgactgccaatagcctgatcgccgaccccacgcagcggcat
gtgcgcccgcccgggcacccgggcagtgcggtggcctacgtgcagcccatgttcgacgac
agcgcgtggcagcgcgtggacctgccacacgattgggcaattgcagggccgttcctggcc
gatggcccgcatggcggcatggggcgattgccgagctggggcgttggctggtatcgcaag
gcgctgcagattccggccagcgaccgcggccgctcgctgtttctcgatctcgatggcgcg
atgtcctacgccaccgtctggctcaacggcaagctggtgggcggctggccgtatggctac
accagctggcgcgtggatctcacgccgtatgtggtgcccggcgggcacaaccagctcacg
atccggctggacaacccgcccgactcggcgcgttggtatcccggcggtggcctgtatcgc
aatgtctggttgaccaagaccggcccgctccgcgttgcccagtggggcacgcagctgagc
acgccgcaggtgtcggccgagcgggcgcaggtgcagctggcggtgcagctggacaatgcc
ggtgccgcccccgtgcaggcgcaggtgagcaccgcgctgtacgcgctggatgacgccagc
ggcctgcgccgtggcccggcggtggcgcagattgccgcggtgcaggtacaggtggcggcg
ggtggcaatgcacgcgtgcagggcagtacgcagatcgaggcgccacggcgttggggtccg
ccaccgacacagcaaccgcatcgctatgtcgcggtgaccgaggtcagccagggtgggcgt
gtggtcgatcgtgtcgaaacgccattcggcgtgcgcagcgtggtcttcgacccggacaag
ggcttagtcatcaacggcgaacacgtgcccatccgcggggtcaacaaccatcacgatctg
ggcgcgctgggggccgcgttcaacgtgcgcgccgccgagcggcagctgcagttactgcaa
cacatgggcgccaatgccatccgcatgagccacaacccgcccgcgccggaattgctggag
ctcaccgaccgcatgggtctgctggtggtggatgaggtgttcgacagctgggaaatgaaa
aagaccccgctggatttccacctgatctttccgcaatggcacgagccggatctgcgcgcc
atgctgcgccgcgaccgcaaccatccctccatcattttgtggagcgtgggcaacgaagtg
ggcgagcaatacaccggcgaagcgggcgccgcgatcgcacgcaggctgcacgccatcgtg
tacgccgaagaccctacgcgcccggcgacggcggcgatgaactacgcctcacccgagatg
ccgctgccggcggcgctggatgtaatcagcctcaattaccagggcgaaggcatccgcgat
acgcccgagttcgaaggcaccgagcgtatccgcaagccgccgcagtacccggccttccat
gccaaattcccgcgcaaggccatcctcagcagcgagacggcctcggcgctgagcagccgc
ggcgtgtacctgtttccggtgagtgcgcagagcagcgcgccggtgcgcgatggccgcggc
ggcgattcggtggctcaccaggtcagtgcgtatgagctgcacgcggtggatttcggctcc
agtgccgacaaggtctttgccgcgttggatcggcatccgttcgtggccggcgagtttgtg
tggaccggcttcgactatctcggcgagcccacgccgtactacagctcacgcagttcctat
tccggcattctggatctggctggcttccccaaggaccgctactggctgtatcaggcgcgc
tggcggccggagctgccgatggcgcacctgctgccgcactggagctggccggggcgcgag
ggccaagtgacgccggtgcacgtgttcacctccggcgacgaggccgagctcttcgtcaac
ggcgtctcgcaaggccgcaagcgcaaggcaccgttgcagtaccggctgcgctgggatgcg
gtggtgtaccaaccgggagagctgcgcgtgcaggcttacaaacatggcaggccgtgggcc
agcgaccgtgtgcagaccgccggccgtgccacgcgcatgcagctcagcgccgaccgcaac
cagatccgtggcgatggcaaggacctgagtttcatcaccgtgcgcctgcttgatgccgac
gggcgccctgcaccgactgcaggtgaccgcttgcgattccgcgtggaaggcgcaggcgaa
ctggtcgccaccgacaacggtgacccgaccaacctggaggccttcgtcctgcccgagcgc
aacgcgttcaacggtctgtgcctggtgatcgtgcgcgccaaaccgggcgcgcaggggccg
atcaccgtgcatgtgcaatccgacacgctgcagtccgccagcgtgcaggtgctggcggaa
tga

DBGET integrated database retrieval system