KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC4118Help
Entry
XCC4118           CDS       T00083                                 

Gene name
xynB
Definition
xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Brite
Enzymes [BR:xcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     XCC4118 (xynB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4900906..4901898)
Genome map
AA seq 330 aa AA seqDB search
MSTHACALLLMLTAGLAPAAQAAPLAAGASKFLGSAYGPQQAPGFTQYWNKLTPENAGKW
GSVEAVRDQMDWSGLDTAYNFAKANGMPFQMHVLVWGNQQPEWIKHLPPAEQRREIEQWF
AAVAQRYPDIDLLEVVNEPLNDPPSKDDNGGGNYLQALGGNGASGWEWVLQSFRLARQQF
PRARLMINDYSITNSPQATQRYLQIVQLLQREQLVDAIGVQEHAFETTPNVAMSVHRANL
DTLASTGLPIYITEFDLDGPSDAQQVASYQRVFPVFWEHPAVAGITLWGYRPGLWRDKEA
ACLIRADGSERPALAWLRDYVAQHPGVRAP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgcatgcatgcgcactgttgttgatgctcaccgctggcctggcgccagccgcg
caggccgcgccgctggcggcgggtgcgtccaagttcctgggcagtgcctacggcccgcag
caggcgccggggtttacccagtactggaacaagctcacgccggaaaacgccggcaagtgg
ggcagtgtggaggcggtgcgcgaccagatggactggagcggcctggataccgcctacaac
ttcgccaaggccaacggcatgccgttccagatgcacgtgctggtgtggggcaaccagcag
ccggaatggatcaagcacctgccgccggccgagcagcgccgcgagatcgagcaatggttt
gccgcggtggcgcagcgctacccggatatcgacctgctggaagtggtcaacgagccgctg
aacgacccgcccagcaaggacgataacggcggcggcaattatctgcaggcgctcggcggc
aacggtgccagcggctgggagtgggtgctgcaatcgttccggctggcgcgccagcagttt
ccgcgtgcacggttgatgatcaacgactacagcatcaccaatagcccgcaggccacgcag
cgttatctgcagatcgtgcagctgttgcagcgcgagcagctggtggatgcgatcggcgtg
caggaacacgcgttcgaaaccacacccaacgtggcgatgtcggtgcaccgcgccaatctc
gacacgctggccagcaccggcctgccgatctacatcaccgaattcgatctggatggccca
agcgatgcgcagcaggtggccagctaccagcgtgtgtttccggtgttctgggagcacccg
gcggtggccggcatcacgctgtggggctatcgccctggcttgtggcgcgacaaggaagcg
gcttgtctcatccgcgccgatggcagcgagcggccggcgctggcctggttgcgcgactac
gtggcccagcatcctggcgtgcgtgcgccgtga

DBGET integrated database retrieval system