KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC4157Help
Entry
XCC4157           CDS       T00083                                 

Definition
epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xcc00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4957404..4959563)
Genome map
AA seq 719 aa AA seqDB search
MTPLWRALPLLLGLAPFAAWADPAFDRCLAGLQTQAAAKGVDAASFQRFTAGLAADPSVL
PLLDAQPEFTTPIWDYLASLVDSQRVSDGQAMLVTHRELLTRLSEQTGVDPATIVAVWGV
ESDYGRITGKRPLLVSLATLSCAGRRQPFFRGEFLALLGLLQQGDLAPEGLTGSWAGAFG
QTQFMPSTYARIAIDGDGDGRRDLVASIPDALASTANYLVKAGWERARPWGMEVRLPAGF
DANKAGRTRRQPLQAWQAAGLLGTDGKPLAPTGLPAETAAALLLPAGPTGPAFLVFRNYD
AIYAYNAAESYALSIALLADRLRGGAGLVASWPTDDPGLGRPERRQLQQLLLARGHQIGE
ADGMVGTATRRAIQVEQTRLGLQPADGRAGQRILTALRTAPPVTGAAVRGTAFTLPAAYP
AFVQSPIVQKASPMSDVTGLRTGDFHGFPSLLIDTPYSTAAISLFGGQLLSFVPKGGQDV
MWLSPTAKQPPTPIRGGAPVCWPYFGRQDQTGDVPAHGFVRTVPWQLTESRREDDGTLVL
TLTPPTFDDLALRLHMTLRIGRTLEQRLVTENVSKAPVRFTQALHNYFRVGDALKVSVQG
LDGLDYLDKYENYAIAHRQQGDWSLRDPRDPGRSDRIYTNAGGHYTLTDPVLGRRIDIRT
EGSRSLVAWNPGEDAASKMADVGTGWRDYVCLEAANAGPDVIELAPGASHTLGQTISVE
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgctgtggcgtgcgttgccgctgctgctgggcctggcgccgttcgccgcctgg
gccgaccccgcgttcgaccgctgcctggccgggctgcagacccaggccgccgccaagggt
gtggatgccgccagcttccagcgcttcaccgccggtctggccgccgaccccagcgtgttg
ccgctgctggacgcgcaaccggaattcaccaccccgatctgggactatctggccagcctg
gtcgatagccagcgcgtgagcgatggccaggccatgttggtgactcaccgcgagctgctc
acccgcctgtccgaacaaaccggcgtggacccggccaccatcgtggcggtgtggggcgtg
gagagcgattacggccgcatcaccggcaagcgcccgttgctggtgtcgctggccacgctg
tcgtgcgccggccgccgccaaccgttcttccgcggcgaattcctggccctgctcggatta
ttgcagcagggcgacctggcgcccgaggggctgaccggctcctgggccggtgcgttcggg
cagacccagttcatgccgtccacctatgcgcgcatcgccatcgacggcgatggcgatggc
cgccgcgacctggtcgccagcattcccgacgcgctggcttccaccgccaactatctggtc
aaggctggctgggaacgcgcccgcccctggggcatggaagtgcgcctgccggccggcttc
gacgccaacaaggccggccgcacccgccgccaaccgctgcaggcctggcaggccgccggc
ctgctcggcaccgacggcaagccgctcgccccgaccgggctgccggccgagaccgccgcc
gccctgttgctgccggccggccccaccggccccgcgttcctggtgttccgcaactacgac
gcgatctacgcctacaacgcggccgaaagctacgctctctcgatcgccctgctggccgat
cgcctgcgcggtggcgccggcctggtcgcctcctggcccaccgacgatcccggcctgggc
cggcccgaacgccggcaactgcagcaactgctgctggcccgcggccaccagatcggcgaa
gccgatggcatggtcggcaccgccacccgccgcgccatccaggtcgagcagacccgcctg
ggcctgcagccggccgatggtcgcgccggccaacgcatcctcaccgccttgcgcaccgcc
ccgccggtgaccggcgccgccgttcgcggcaccgcgttcacgctgccggcggcctatccc
gcattcgtccaatctcccatcgtccagaaggcatcccccatgtccgacgtcaccggcctg
cgcacaggcgacttccacggttttccctcgctgctgatcgacaccccgtattccaccgcg
gccatcagcctgttcggcggccaactgctgtcgttcgtgcccaagggcgggcaggacgtg
atgtggctgtcgcccaccgccaagcagccgcccacgcccatccgcggcggcgcgccggtg
tgctggccgtatttcggccgccaggatcagaccggtgacgtgccggcgcacggcttcgtc
cgcacggtgccgtggcagctcaccgagagccgccgcgaagacgacggcactttagtgctc
acgctcacgccgccgaccttcgatgacctggcgctgcgcctgcacatgaccctgcgcatc
ggccgcacgctagaacaacgcctggtcaccgaaaacgtcagcaaggcgccggtgcgcttc
acccaggccctgcacaactacttccgcgtcggcgacgcgctcaaagtgagcgtgcagggc
ctggacgggctggactatctcgacaagtacgagaactacgccatcgcgcaccgccagcag
ggcgactggagcctgcgcgatccgcgcgaccccggccgcagcgaccgcatctacaccaac
gccggcggccactacaccctcaccgacccggtgctgggccgccgcatcgacatccgcacc
gaaggcagccgctcgctggtggcctggaatccgggcgaagacgccgccagcaagatggcc
gacgtcggcaccggctggcgcgactacgtctgcctggaagccgccaacgccggccctgac
gtgatcgaactggcgcccggcgccagccacacgctgggccagaccatcagcgttgaataa

DBGET integrated database retrieval system