KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC4198Help
Entry
XCC4198           CDS       T00083                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XCC4198 (recD)
Enzymes [BR:xcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     XCC4198 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5006813..5009050)
Genome map
AA seq 745 aa AA seqDB search
MNHPNLLTALNQAGALRTLDLAFAQSLQRLAPDTDPQVLAGAALASLAVTSGHAGLDPTR
AAMLLDAREGPSPALPDPTDWQRTLAASRWVDQPNPQEPAAADCPLVLEHGLLYLRRYRE
YERRLALGLQRIAAHSPPPFAAATLAPLFEQLFPQASPLPQGEGARRAGEGTGLPEPSIY
QDGTNPPEPSHHQDHQAQAAALALRRTLLLVTGGPGTGKTTTIARLLLLRIAQAHASNTP
APRIALAAPTGRAAERMAESLRAAVARAIANGIDPALADALPTGASTLHRLLGVIPDSPQ
FRHTADNPLPFDLIVVDEASMVDLPLMCKLVEAVADGTQLILLGDADQLPSVEAGDVLAA
ILQAAGPGDTLQPQDADALQPLLGSAPPGSTPASIQTGGHTISHTHTGGLAGHRVHLLRG
YRQADNFALTPLADAIRTSDADTALALLRSGELAGVHFHEDGEDPLALGRDALLAHWRAL
ADAHDPAAALRDAARLRLLTAVRAGPQGARGLNARIEQLLAESGSGARRLGSASPWFQGR
LLLITENSYRHGLFNGDVGICLRSEASPFSERSDTNAPSERSDASTVTARSDAAASSGPS
HSIGTANRADPVAERRAQGPLVAWFEGDGDSQVRGFHPAALPAHESAFAMTVHKAQGSEF
DTVWLQLPTRDARVLSRELLYTGITRARRALHLAGSEAALRAALARHAARISGLAWRLGG
EQMQPAPVEQTAEPPTVTPVQGSLF
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacccaaacctcctaaccgccctcaaccaggccggcgccctacgcacgctagat
ctggccttcgcccagagcctgcaacgcctggccccggacaccgacccccaggtgttggcc
ggcgccgcactcgcctcactggccgtcaccagcggccacgcagggctggatcccacccgc
gccgccatgctgctggatgcgcgcgaggggccatcgcccgcgctcccggacccaaccgac
tggcaacgcaccctggccgcctcgcgctgggtcgaccaaccgaatccgcaagagccggcc
gccgccgactgcccgctagtcctcgaacacggcctgctctacctgcgccgctaccgcgag
tacgaacgccgcttggcactaggtctgcaacgcatcgccgcccattcgccgccgcccttc
gccgccgccacgctagccccgctgttcgagcagttattcccccaggcttcccctctcccc
cagggagagggtgcccgaagggcgggtgagggtacgggcctgcccgagccatccatctac
caagacggcacgaacccacccgagccatcccaccaccaagaccaccaagcccaagccgcc
gccctcgccctacgccgcaccctgctgctggtcaccggcggccccggcaccggcaagacc
accaccatcgcccgcctgctgttgctgcgcatcgcccaagcacacgcatccaacaccccg
gccccgcgcatcgccctggccgcacccaccggccgcgccgccgagcgcatggccgaaagc
ctgcgcgccgccgtcgcgcgcgccatcgccaacggcatcgacccggccctggccgacgcc
ctgcccaccggtgccagcaccctgcatcgcctgctcggcgtcatcccggactccccgcag
ttccgccacaccgccgacaacccgttgccattcgacctgatcgtcgtcgacgaggcttcc
atggtcgacctgccgctgatgtgcaagctggtcgaagccgtggccgacggcacccagctg
atcctgctcggcgacgccgaccagctaccctcggtggaagccggcgacgtgctcgccgcc
atcctgcaggccgccggccccggcgataccctgcagccgcaagacgccgacgcgctgcaa
ccgctgctcggcagcgccccccctggcagcacgcctgccagcatccagaccggcggccac
accatcagccacacccacaccggcggcctcgcaggccaccgcgtccacctgctacgcggc
taccgccaagcagacaactttgcactcaccccgttggccgacgccattcgcaccagcgac
gccgacaccgccctggccctgctacgcagcggcgaactggccggcgtgcacttccacgaa
gacggcgaggacccgctggccctgggccgcgacgcactgctcgcgcactggcgcgcgctg
gctgatgcacacgaccccgccgccgccctgcgcgatgccgcgcgcctgcgcctgctcacc
gccgtacgcgccggcccgcaaggtgcgcgcggcctcaacgcccgcatcgaacaactgctg
gccgaatccggctccggcgcccgccgcctcggcagcgcctcgccctggttccagggccgc
ctgctgctgatcaccgaaaacagctaccgccacggcctgttcaacggcgacgtcggcatc
tgcctgcgcagcgaagcgagtcccttttcggagcgaagcgacacaaacgctccctcggag
cgcagcgacgcgagcaccgttacagcgcgtagcgacgcagctgcgtcttccggcccaagc
cacagcatcggcaccgcaaatcgcgccgaccccgtcgccgaacgccgtgcccaaggcccg
ttggtcgcctggttcgaaggcgacggcgacagccaggtacgcggcttccaccccgccgcc
ttgcccgcccacgaaagcgctttcgccatgaccgtgcataaagcccagggcagcgaattc
gacaccgtctggctgcaattgcccacccgcgacgcccgcgtgctcagccgcgaactgctc
tacaccggcatcacccgcgcccgccgcgccctgcacctggccggcagcgaggcagctctg
cgcgcagcgctcgcacggcacgccgcgcgtatctccggcctggcgtggcggttgggtggg
gagcagatgcagccggcacccgttgagcaaacagcagaaccacccactgtcacgcctgtg
caggggtcgttgttctga

DBGET integrated database retrieval system