KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC4213Help
Entry
XCC4213           CDS       T00083                                 

Gene name
btuE
Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00480  Glutathione metabolism
xcc00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    XCC4213 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XCC4213 (btuE)
Enzymes [BR:xcc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XCC4213 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 1001258
NCBI-ProteinID: NP_639547
UniProt: Q8P365
Position
complement(5030142..5030687)
Genome map
AA seq 181 aa AA seqDB search
MSQSIHDIPVTDINGGATSLAAHRGKVLLVVNVASKCGLTPQYEGLEALYRDKQAQGLEV
LGFPANDFNGQEPGSEAEIAQFCQLTYDVTFPLFSKIAVTGAEIHPLYQALTSAQPQATG
DGPMREKLAGYGIAANPAPGVLWNFEKFLIGRDGQVIERFAPDVAADDVRLRQAVDAALA
H
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagccagagcatccacgacattcccgtgaccgacatcaacggtggcgccaccagcctg
gccgcgcatcgcggcaaggtgctgctggtggtcaacgtcgcctccaagtgcgggctgact
ccccagtacgaaggcctggaagcgctgtaccgcgacaagcaggcccagggcctggaagtg
ctgggtttcccggccaacgacttcaatgggcaggagcccggcagcgaggcggagatcgcc
cagttctgccagcttacctatgacgtcaccttcccgctgttctccaagatcgccgtcacc
ggcgccgagatccatccgttgtaccaggcgctgaccagcgcacagccgcaggccaccggc
gatggcccgatgcgcgaaaagctggccggctacggcatcgccgccaacccggcaccgggc
gtgttgtggaacttcgaaaaattcctgatcggccgcgacggccaggtcatcgaacgcttc
gcacccgacgtcgccgccgatgacgtccgcctgcgccaggccgtcgatgcggcgttggcg
cactaa

DBGET integrated database retrieval system