KEGG   Xylanimonas cellulosilytica: Xcel_0110Help
Entry
Xcel_0110         CDS       T01135                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
xce  Xylanimonas cellulosilytica
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Xcel_0110
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Xcel_0110
Enzymes [BR:xce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Xcel_0110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(119724..120980)
Genome map
AA seq 418 aa AA seqDB search
MPRARSRTATAVAAMGLAVVGMLASCAGGGAATPSPAPPVTASPSPSPSPTAPPAPSPSP
SSSPTTTPAPSPTPSEADPIAGWTLEQKVGRLLMVGRPLDGDSDLTARLVAERHVGGVFL
HGRSHEPVEQVRAIVDPLRTLATDPPGLLVATDPPGLLVATDQEGGRVQVLQGPGFDAMP
SAVEQLGLPDLRAQAAGWGAQLAAAGVDVNLGPVADLVPADIGAANPPIGAFDRNYGSTA
AEVVAGAGAFAAGMQDAGVVPTLKHFPGLGRVTANTDTSADVVDAVTTADDASVGVFRDV
LAASSAEPRPWVMMSTAVYGLIDPERPAAFSPTVVGLLRDRLGFDGVVITDDVSAAAQVQ
AWSPGDRAVLAIDAGVDVVLASADPTVADEMLDALLARAESDPAFATKVDDAARRLTR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccccgggcgcggtcccgcacggcgaccgccgtcgccgcgatgggcctcgccgtcgtc
gggatgctggcgtcgtgcgccggtggaggtgcggcgacgccgtcacccgcacccccggtc
acggcgtcgccatcgccaagccccagcccgacggcgccgcccgcgccgtcgccctccccc
tcatcgagcccgacgacgacgccggccccgagccccacgccgtcggaggccgacccgatc
gcgggctggaccctcgagcagaaggtggggcggctgctcatggtgggccgcccgctcgac
ggtgactccgacctgaccgcgcggctcgtcgcggagcggcacgtcggcggggtcttcctg
cacggccgctcgcacgaaccggtcgagcaggtgcgggcgatcgtcgacccgctgcgcacc
ctggccaccgacccgcccgggctgctggtcgccaccgacccgcccgggctgctggtcgcc
accgaccaggagggcggccgggtccaggtgctccaagggccgggcttcgacgcgatgccg
tcggcggtcgagcagctcggcctgcccgacctgcgggcgcaggccgcaggctggggcgcg
cagcttgccgcggccggggtcgacgtcaacctcggcccggtcgccgacctcgtcccggcc
gacatcggcgccgccaacccgcccatcggtgcgttcgaccgcaactacgggagcacggcg
gcggaggtcgtcgcgggcgccggggcgttcgccgccggcatgcaggacgcgggcgtcgtc
cccaccctcaagcacttccccgggctcggccgggtcaccgccaacacggacacgtcggcc
gacgtcgtcgacgccgtcaccaccgccgacgacgcatccgtcggagtgttccgcgacgtg
ctcgcggcgtcgtcggcggaaccacggccgtgggtcatgatgtcgacggcggtgtacggg
ctcatcgacccggagcggccggccgcgttctccccgaccgtggtggggctgctgcgcgac
cgcctcgggttcgacggcgtcgtcatcacggacgacgtctcggcggccgcgcaggtgcag
gcgtggtctccgggcgatcgcgcggtgctggcgatcgacgcgggcgtcgacgtcgtcctg
gcgagcgccgacccgaccgtggcggacgagatgctcgacgccctcctggcccgcgcggag
tcggacccggccttcgcgaccaaggtcgacgacgcggcccgccgcctgacccggtga

DBGET integrated database retrieval system