KEGG   Xylanimonas cellulosilytica: Xcel_0236Help
Entry
Xcel_0236         CDS       T01135                                 

Definition
glycoside hydrolase family 6
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Xcel_0236
Enzymes [BR:xce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Xcel_0236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
280475..281980
Genome map
AA seq 501 aa AA seqDB search
MQSRTRTTRTTRTLAALATAALAGATLLATSAPASASRSETLWVNPNSSTTEHITELKLK
GQARDDARLLAGYATATWFTGETPKKVRNAVRDVVRSADRARAVPTLVAYNLPFRDCSQY
SAGGATSQAEYEAWIDGFAAGIGDERAIVILEPDGLGIIPWYTTFEGTQEWCQPEEADPA
TAADERFAMLNHAVDVLAALPNTDVYLDAGHSGWLNVGDNTDRLIKAGVQKADGFYLNAS
NYQYTENSVAYGRWISSCIALVTEVGGALADCGNQYWNGGPLSDWEGVEMTKYAPWTADP
TAPLERRTDVLDDRYAQALGGVQPTARFVVDTSRNGQGPWDPATSDVGYDPLDSAEDWCN
PPGRGLGLRPTLQTGDPLVAAYLWIKVPGESDGLCHRGLGGPLDPERGIEDPAAGQWFVQ
QARELIELAVPAVKGDERCRDGKGGKGDRDGKGDRDGKGDRDGRGGKAGRADRGDKGDRD
RDRHDSGKRDVRTSDRDARSR
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
ttgcagtcacgcacccgcaccacgcgcaccacccgcactctggccgccctcgcgaccgcc
gcgctcgccggcgcgaccctgctcgccacgagcgccccggcctccgcctcccggagcgag
acgctctgggtcaacccgaacagctcgaccacggagcacatcactgagctgaagctcaag
ggccaggcccgcgacgacgcccgcctgctcgcgggctacgccaccgcgacctggttcacg
ggcgagaccccgaagaaggtgcgcaacgccgtccgcgacgtcgtacgcagcgccgaccgc
gcccgcgccgtccccaccctggtggcgtacaacctcccgttccgcgactgttcccagtac
tccgcgggcggcgcgacgtcgcaggccgagtacgaggcgtggatcgacggcttcgcggcc
ggcatcggcgacgagcgcgccatcgtcatcctcgagccggacgggctggggatcatcccc
tggtacaccacgttcgagggcacgcaggagtggtgccagccggaggaggcggaccccgcg
accgcggccgacgagcggttcgcgatgctcaaccacgcggtggacgtgctcgccgcgctg
cccaacaccgacgtctacctcgacgccggccactcgggctggctcaacgtgggcgacaac
accgaccgcctgatcaaggccggcgtccagaaggccgacgggttctacctcaacgcctcc
aactaccagtacacggagaactcggtggcatacggccgctggatctcctcgtgcatcgcg
ctcgtcaccgaggtgggcggagcgctcgccgactgcggcaaccagtactggaacggcggc
ccgctgagcgactgggagggcgtggagatgaccaagtacgcgccgtggaccgccgacccg
acggccccgctcgagcggcgcacggacgtcctcgacgaccggtacgcgcaggcgctgggc
ggcgtgcagcccaccgcgcggttcgtcgtcgacacctcacgcaacggtcagggtccgtgg
gacccggcgacgtcggacgtcggctacgacccgctggactcggccgaggactggtgcaac
ccgcccggacgcggcctcgggctgcggccgacgctgcagaccggcgacccgctggtcgcg
gcgtacctgtggatcaaggtgcccggtgagtcggacggcctgtgccaccgcggcctgggc
ggcccgctcgaccccgagcgcggcatcgaggacccggcggccggccagtggttcgtccag
caggcgcgcgagctgatcgagctggcggtcccggctgtcaagggcgacgagcgctgccgg
gacggcaagggcggcaagggcgaccgggacggcaagggggaccgggacggcaagggcgac
cgggacggtcgcggcggcaaggccggcagggccgaccggggtgacaagggcgaccgggat
cgcgaccggcacgactccggtaagcgtgacgtcaggacgtccgaccgtgacgccagaagc
cgatga

DBGET integrated database retrieval system