KEGG   Xylanimonas cellulosilytica: Xcel_0272Help
Entry
Xcel_0272         CDS       T01135                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
xce  Xylanimonas cellulosilytica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xce00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Xcel_0272
DNA repair and recombination proteins [BR:xce03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Xcel_0272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
326946..327554
Genome map
AA seq 202 aa AA seqDB search
MAGVYEGAVQDLIDELGRLPGVGPKSAQRIAFHLLAADAGDVRRLADALIEVKARVRFCE
VCGNVAEAERCRVCVDPRRSDDVICVVEEPKDVVAIERTREFRGRYHVLGGAINPIENVG
PDDLRIKDLLSRLADGRVQEVILATDPNVEGEATATYLARLIGPMGVTVSRLASGLPVGG
DLEYADEVTLGRAFEGRRVVGR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggtgtgtatgagggcgcggttcaggatctgatcgacgagctcgggcgactgcct
ggggtcgggccgaagagtgcccagcggatcgcgttccatctgctcgcggccgacgccggt
gacgtgcgccgcctcgcggacgcgctcatcgaggtcaaggcgcgggtgcggttctgcgag
gtgtgcgggaacgtcgccgaggcggagcggtgccgggtgtgcgtcgacccgcggcggtcc
gacgacgtcatctgcgtcgtcgaggaacccaaggacgtcgtcgccatcgagcgcacgcgc
gagttccgcggccggtaccacgtgctcggcggcgccatcaacccgatcgagaacgtaggc
cccgacgacctgcgcatcaaggacctgctctcgcgtctggccgacggccgcgtgcaggag
gtcatcctcgccaccgacccgaacgtggagggcgaggccacggccacctacctggcccgc
ctcatcgggccgatgggcgtcacagtgtcccgcctcgcctccggcttgccggtcggggga
gacttggagtacgccgacgaggtcacgctcgggcgggcgttcgagggacgccgcgtcgtc
ggacgttga

DBGET integrated database retrieval system