KEGG   Xylanimonas cellulosilytica: Xcel_0318Help
Entry
Xcel_0318         CDS       T01135                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xcel_0318
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xcel_0318
   00620 Pyruvate metabolism
    Xcel_0318
   00640 Propanoate metabolism
    Xcel_0318
  Energy metabolism
   00680 Methane metabolism
    Xcel_0318
Enzymes [BR:xce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Xcel_0318
Lipid biosynthesis proteins [BR:xce01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Xcel_0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(376376..378373)
Genome map
AA seq 665 aa AA seqDB search
MTTHPEAASLENLLHETRSFPPASAFAAQANAQPSLYAEAAADRPEFWARQARELVSWRT
PFTQTLDWSDAPVARWFADGTLNAAYNAVDRHVEAGHGDRVAIHFEGEPGDTRTVTYADL
QREVARAANALAALGVSKGDRVVIYLPMLVESVVAMLACARIGAPHSVVFGGFSADALRS
RIADAEATLVITADGGYRRGAASALKPAVDEALTGAGTDTVRHVLVVRRTGQETAWTPGR
DIWWHEALESADTFHEPVWVDAEHPLFILYTSGTTGKPKGILHTTGGYLTQCAYTHRNVF
DLKDDDVYWCTADIGWVTGHSYVVYGPLTNGATQLLYEGTPDTPHRGRWWELIEKYGVSI
LYTAPTAIRTCMKWGEDIPSAFDLSSLRLLGSVGEPINPEAWIWYRRVIGGDTTPIVDTW
WQTETGAIMISPLPGVTAAKPGSAQVPLPGIAADVVDDEAKPVPDGGGGYLVLTEPWPSM
LRGIWGDRQRYEDTYWSRFRGLYFAGDGAKKDDDGDIWLLGRVDDVMNVSGHRLSTTEIE
SALVSHDIVAEAAVVGASDDMTGQAVVAFVILRGEHAGRAATPDGAEQVQAELRAHVAKE
IGPIAKPKRILVVAELPKTRSGKIMRRLLRDVAENRAVGDATTLADSSVMDLITAGLAAG
KSADD
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
ttgaccacgcaccctgaggccgcgagcctcgagaacctgctgcacgagacccggtcgttc
ccgccggcctccgccttcgcggcgcaggccaacgcgcagccctcgctctacgcggaggct
gccgccgaccgccctgagttctgggcccggcaggcccgcgagctcgtctcgtggcgcacc
ccgttcacccagaccctcgactggtccgacgcgccggtcgcgcgctggttcgccgacggc
accctcaacgccgcctacaacgccgtcgaccggcacgtcgaggccgggcacggcgaccgc
gtcgccatccacttcgagggcgagccgggcgacacccgcaccgtcacctacgcggacctg
cagcgcgaggtcgcacgggcggccaacgccctcgccgcgctcggcgtgagcaagggcgac
cgcgtcgtcatctacctgccgatgctggtcgagtccgtcgtcgccatgctggcgtgcgcg
cgcatcggcgccccgcactccgtggtgttcggcgggttctccgccgacgcgctgcgcagc
cgcatcgcggacgccgaggccacgctcgtgatcaccgccgacggcggctaccggcgcggg
gcggcgagcgcgctgaagcccgccgtcgacgaggcgctgacgggcgcgggcaccgacacg
gtcaggcacgtgctggtcgtgcgccgcacgggccaggagaccgcctggacgccgggccgc
gacatctggtggcacgaggccctggagtcggcggacaccttccacgagcccgtgtgggtg
gacgccgagcacccgctgttcatcctctacacctccggcaccaccgggaagccgaagggc
atcctgcacaccacgggcggctacctcacccagtgcgcctacacccaccggaacgtgttc
gacctcaaggacgacgacgtctactggtgcaccgccgacatcggctgggtgacgggccac
tcctacgtcgtctacggtccgctgaccaacggggccacacagctcctctacgagggcacc
ccggacaccccgcaccgcggccgctggtgggagctcatcgagaagtacggcgtctcgatc
ctctacaccgcccccaccgcgatccgcacgtgcatgaaatggggcgaggacatcccgtcg
gccttcgacctgtcctcgctgcgcctcctgggctcggtgggcgagcccatcaaccccgag
gcgtggatctggtaccgccgcgtcatcggcggggacaccacccccatcgtcgacacgtgg
tggcagacggagacgggcgcgatcatgatcagcccgctcccgggcgtcacggccgccaag
ccggggtccgcccaggtgccgctgccgggcatcgccgccgacgtcgtcgacgacgaggcc
aagcccgtgcccgacggcggtggcggctatctggtgctcaccgagccgtggccgtcgatg
ctgcgcggcatctggggcgaccggcagcgctacgaggacacctactggtcgcggttccgg
ggcctgtacttcgcgggcgacggcgccaagaaggacgacgacggcgacatctggctgctc
ggccgcgtcgacgacgtcatgaacgtctcggggcaccggctgtcgaccacggagatcgag
tcggcgctcgtctcgcacgacatcgtggccgaggccgccgtggtcggcgcctccgacgac
atgacgggacaggccgtggtcgcgttcgtgatcctgcgtggcgagcacgccggtcgcgcg
gcgacgcccgacggcgcggagcaggtccaggccgagctgcgggcccacgtggccaaggag
atcggcccgatcgccaagccgaagcgcatcctggtggtggccgagctccccaagacccgc
tcgggcaagatcatgcgccgcctgctgcgcgacgtcgccgagaaccgcgccgtcggcgac
gcgaccaccctggccgactcctccgtcatggacctgatcaccgccggcctcgcggcaggc
aagtccgcagacgactga

DBGET integrated database retrieval system