KEGG   Xylanimonas cellulosilytica: Xcel_0657Help
Entry
Xcel_0657         CDS       T01135                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
xce  Xylanimonas cellulosilytica
Pathway
xce00010  Glycolysis / Gluconeogenesis
xce00520  Amino sugar and nucleotide sugar metabolism
xce01100  Metabolic pathways
xce01110  Biosynthesis of secondary metabolites
xce01120  Microbial metabolism in diverse environments
xce01130  Biosynthesis of antibiotics
xce01200  Carbon metabolism
Module
xce_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xcel_0657
   00520 Amino sugar and nucleotide sugar metabolism
    Xcel_0657
Enzymes [BR:xce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Xcel_0657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK LRV
Motif
Other DBs
NCBI-ProteinID: ACZ29696
JGI: Xcel_0657
UniProt: D1BWW4
Position
complement(710112..710879)
Genome map
AA seq 255 aa AA seqDB search
MSETLTLAVDCGGGGIKAAVLDEAGTAHAAPVRVPTPYPLPPTRLVDTIAEIAGGLPHAH
RVTVGMPGMIRHGVVVHTPHYITRSGPRSRVEPELREAWASFDVRAAVAERLGVPALVLN
DAEVHGAGVIAGSGFELVLTLGTGLGSALFDGGSLAPHLELSHAPFRRFATYDEYIGEPE
RRRLGDGLWSRRVVALVEGLRPVFWWDRLYLGGGNSRRITPTALARLGDDVVIVPNSAAL
VGGARAWELPRETWG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgagacgctcaccctcgcggtcgactgcggcggcggcggcatcaaggctgccgtg
ctcgacgaggccggcaccgcccacgccgcgccggtccgcgtgccgacgccgtaccccctg
cccccgacccggctcgtcgacacgatcgccgagatcgccggcggcctgccgcacgcgcac
cgcgtcaccgtcgggatgccggggatgatccgccacggcgtcgtcgtgcacacgccgcac
tacatcacccgatcgggcccacgttcccgcgtggagcccgagctgcgggaggcgtgggcg
agcttcgacgtccgggccgccgtcgcggagcggctcggcgtgcccgcgctggtgctcaac
gacgccgaggtgcacggggccggggtgatcgccggctccgggttcgagctcgtcctcacg
ctcggcacggggctggggtcggcactgttcgacggcggcagcctcgccccgcacctcgag
ctgtcgcacgcaccgttccgccgcttcgcgacctacgacgagtacatcggcgagccggag
cgccgccgcctcggcgacggcctgtggtcgcggcgggtcgtggcgctggtggaagggctg
cgccccgtgttctggtgggaccgcctctacctcggcggcggcaactcgcgtcgcatcacc
ccgacagcgctggcccgcctcggcgacgacgtcgtcatcgtgccgaactccgccgcgctg
gtgggtggggcgcgggcgtgggagctcccgcgcgagacgtggggctga

DBGET integrated database retrieval system