KEGG   Xylanimonas cellulosilytica: Xcel_0671Help
Entry
Xcel_0671         CDS       T01135                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:xce00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:xce00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(724263..724757)
Genome map
AA seq 164 aa AA seqDB search
MGKEIYDIPFRRMDGTTTTLAQLAGDDRVVLVVNVASRCGLTPQYEQLETLQEKYGDRGL
TVVGFPSNQFLQELGSNEAIAEFCSTTYGVTFPVMDRIRVNGHRTAPLYEALKKTADAGG
HDGRIRWNFEKFLVLPGGTVHRYDPRTLPDAPEIIDEIESHLPA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggagatctacgacatcccgttccggcgcatggacgggacgacgacgacgctg
gcacagctcgccggggacgaccgcgtcgtcctggtggtcaacgtggcgtcccggtgcggg
ctgaccccgcagtacgagcagctcgagacgctccaggagaagtacggcgaccgcggactc
accgtcgtcggcttcccctcgaaccagttcctgcaggagctcggctccaacgaggcgatc
gccgagttctgctccacgacgtacggcgtgacgttccccgtcatggaccgcatccgggtc
aacggccaccgcaccgccccgctgtacgaggccctcaagaagaccgccgacgccggcggc
cacgacggccgcatccgctggaacttcgagaagttcctcgtcctccccggcggcaccgtc
caccgctacgacccgcgcaccctcccggacgcccccgagatcatcgacgagatcgagtcg
cacctccccgcctga

DBGET integrated database retrieval system