KEGG   Xylanimonas cellulosilytica: Xcel_0671Help
Entry
Xcel_0671         CDS       T01135                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
xce  Xylanimonas cellulosilytica
Pathway
xce00480  Glutathione metabolism
xce00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Xcel_0671
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Xcel_0671
Enzymes [BR:xce01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Xcel_0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ACZ29710
JGI: Xcel_0671
UniProt: D1BWX8
Position
complement(724263..724757)
Genome map
AA seq 164 aa AA seqDB search
MGKEIYDIPFRRMDGTTTTLAQLAGDDRVVLVVNVASRCGLTPQYEQLETLQEKYGDRGL
TVVGFPSNQFLQELGSNEAIAEFCSTTYGVTFPVMDRIRVNGHRTAPLYEALKKTADAGG
HDGRIRWNFEKFLVLPGGTVHRYDPRTLPDAPEIIDEIESHLPA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggagatctacgacatcccgttccggcgcatggacgggacgacgacgacgctg
gcacagctcgccggggacgaccgcgtcgtcctggtggtcaacgtggcgtcccggtgcggg
ctgaccccgcagtacgagcagctcgagacgctccaggagaagtacggcgaccgcggactc
accgtcgtcggcttcccctcgaaccagttcctgcaggagctcggctccaacgaggcgatc
gccgagttctgctccacgacgtacggcgtgacgttccccgtcatggaccgcatccgggtc
aacggccaccgcaccgccccgctgtacgaggccctcaagaagaccgccgacgccggcggc
cacgacggccgcatccgctggaacttcgagaagttcctcgtcctccccggcggcaccgtc
caccgctacgacccgcgcaccctcccggacgcccccgagatcatcgacgagatcgagtcg
cacctccccgcctga

DBGET integrated database retrieval system