KEGG   Xylanimonas cellulosilytica: Xcel_0922Help
Entry
Xcel_0922         CDS       T01135                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xcel_0922
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Xcel_0922
   00630 Glyoxylate and dicarboxylate metabolism
    Xcel_0922
Enzymes [BR:xce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Xcel_0922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(991118..992767)
Genome map
AA seq 549 aa AA seqDB search
MSTLTDSPILTRTSVLPARRATPRDAEILTPEALDFLALLHEQFADGVAEILAARDRYAR
AVAGGQDPDFDPVTRPVRDSAWQVAGCAGAPGLEDRRVEITGPTDPKMTINALNSGARVW
LADAEDASAPTWENVVGGQLALRDAIRGTLAFTSAEGKDYRLRSEHLTDLPTIVFRPRGW
HLPEAHLRVRHADGSLTAASGALVDFGLYLFHNAAALIERGRGPYFYLPKLEGYREARLW
NRVFETAQDALGIPRGTIRATVLIETLPAAFAMEEILYELREHAAGLNAGRWDYLFSIIK
NLRTRGTGFVLPDRNQVTMTAPFMRAYTELLVATCHRRGAHAIGGMSAFIPDRRRPDVTE
RALDKVREDKRREAGDGFDGTWVAHPDLIGTALAEFDAVLGDQPHQVARQRPEVTVGQAE
LLDVASASRAGATVTECGLRSNISVGVRYIASWLRGTGAAALDNLMEDAATAEISRSQVW
QWIAAGVRTEHGVVTRERAGLVLDEVLAGLERFDGDRYDDAAAVFREAALGETFPPFLTT
IAYDRHLAH
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgctcaccgacagccccatcctcacccgcacctccgtcctgcccgcccgtcgc
gccacgccgcgcgacgccgagatcctcacccccgaggcgctcgacttcctcgccctgctg
cacgagcagttcgccgacggcgtcgccgagatcctcgccgcccgggaccggtacgcgcgc
gccgtcgccggtggccaggaccccgacttcgacccggtcacgcggccggtccgggactcc
gcgtggcaggtggcgggctgcgccggtgcccccgggctggaggaccgccgcgtcgagatc
accggccccaccgaccccaagatgacgatcaacgccctcaactccggtgcccgcgtctgg
ctcgcggacgcggaggacgcgagcgcacccacgtgggagaacgtcgtcggcggccagctc
gccctgcgggacgccatccgcgggacgctcgccttcaccagcgccgagggcaaggactac
cgcctgcgctccgagcacctgacggacctgccgacgatcgtgttccggccgcgcggctgg
cacctgcccgaggcgcacctgcgggtccggcacgcggacgggtcgctcacggcggcgtcc
ggcgcgctggtcgacttcgggctgtacctcttccacaacgcggcagcgctcatcgagcgc
gggcgcgggccgtacttctacctgccgaagctggaggggtaccgcgaggcgcggctgtgg
aaccgcgtcttcgagaccgcgcaggacgccctcggcatcccccgggggacgatccgcgcg
acggtgctcatcgagaccctgcccgccgcgttcgcgatggaggagatcctctacgagctg
cgcgagcacgccgccgggctcaacgccggccgctgggactacctgttctcgatcatcaag
aacctgcgcacgcgaggcaccgggttcgtgctgccggaccgcaaccaggtcacgatgacg
gcgccgttcatgcgcgcgtacacggagctgctggtcgcgacctgccaccggcgcggcgcc
cacgccatcggcgggatgagcgcgttcatccccgaccgacgccgaccggacgtcaccgag
cgggcgctcgacaaggtgcgcgaggacaaacggcgcgaggcgggcgacgggttcgacggc
acctgggtggcgcaccccgacctcatcggcacggccctcgcggagttcgacgccgtcctc
ggggaccagccgcaccaggtcgcgcggcagcgccccgaggtgacggtcggccaggcggag
ctgctcgacgtcgcctccgcctcgcgggccggcgcgaccgtcaccgagtgcgggctgcgc
tccaacatctcggtgggcgtgcgctacatcgcctcctggctgcgcggcaccggcgcggcc
gcgctcgacaacctcatggaggacgccgcgaccgcggagatctcacggtcgcaggtgtgg
cagtggatcgccgcgggcgtccgcaccgagcacggcgtggtcacccgcgagcgcgcaggc
ctcgtgctcgacgaggtcctcgcgggcctggagcggttcgacggcgaccggtacgacgac
gccgccgccgtcttccgcgaggcggcgctgggcgagacgttccccccgttcctgacgacg
atcgcctacgaccgccacctggcgcactaa

DBGET integrated database retrieval system