KEGG   Xylanimonas cellulosilytica: Xcel_0923Help
Entry
Xcel_0923         CDS       T01135                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:xce01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:xce00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(992869..994197)
Genome map
AA seq 442 aa AA seqDB search
MTALTDRSASPTAPGVRAGDTVQTAAELAAAWATDPRWTDVERTYTADDVVALRGSVIEE
HTLARRGAELLWERLHTSEFVNALGALTGNQAVQQVKAGLRAIYLSGWQVAGDANAAGQT
YPDQSLYPANSVPQVVRRINNALLRADQVERLEGTRTVEDWLAPIVADAEAGFGGPLNAY
ELMRSMITAGAAGVHWEDQLASEKKCGHLGGKVLVPTQQHIRTLNAARLAADVEGVPTVV
VARTDAEAATLLTSDVDERDRPFLTGGRTAEGFYEVRPGLETSIARARAYAPYADLLWME
TGTPSLEVARAFAEGVRSEFPDQLLAYNCSPSFNWRRHLSEAEIATFQRELGAMGYAFQF
ITLAGFHALNHSMFDLAHGYAREQMTAYVRLQESEFASESRGYTATKHQREVGTGYFDRV
ATALNPTASTLALAGSTESAQF
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgctcaccgaccgctccgcctccccgaccgcccccggcgtccgtgccggcgac
acggtccagaccgccgccgagctcgccgccgcatgggcgaccgacccgcgctggaccgac
gtcgagcgcacgtacaccgccgacgacgtcgtcgccctgcgcggttcggtgatcgaggag
cacacgctcgcccgccgcggcgccgagctgctctgggagcggctgcacaccagcgagttc
gtcaacgcgctcggcgcgctcacggggaaccaggcggtgcagcaggtcaaggcgggcctg
cgggccatctacctgtccggctggcaggtcgccggcgacgccaacgcggccggccagacc
tacccggaccagtcgctgtacccggccaactccgtgccgcaggtggtgcggcgcatcaac
aacgcgctcctgcgcgccgatcaggtcgagcgcctcgagggcacccgcaccgtcgaggac
tggctcgcccctatcgtcgccgacgccgaggccgggttcggcggcccgctcaacgcctac
gagctcatgcgctcgatgatcaccgccggcgccgcaggcgtgcactgggaggaccagctc
gcctcggagaagaagtgcggccacctgggcggcaaggtgctggtgcccacgcagcagcac
atccgcacccttaacgccgcgcgtctggccgccgacgtcgagggcgtgcccaccgtcgtc
gtcgctcgcaccgacgccgaggcggccacgctgctgacctccgacgtcgacgaaagggac
cggccgttcctcaccggcggccgcaccgccgaggggttctacgaggtgcggcccggactc
gagacctcgatcgcccgcgcgcgggcctacgccccctacgccgacctgctgtggatggag
acggggacgccgtcgctcgaggtcgcgcgggccttcgccgagggcgtgcgcagcgagttc
ccggaccagctcctggcctacaactgctcgccgtcgttcaactggcgccgccacctctcg
gaagcggagatcgcgaccttccagcgcgagctcggggcgatgggctacgcgttccagttc
atcaccctggccgggttccacgccctcaaccactcgatgttcgacctcgcgcacgggtac
gcccgcgagcagatgaccgcctacgtgcggctccaggagtccgagttcgcctccgagagc
cgcggctacaccgccaccaagcaccagcgcgaggtcggcaccggctacttcgaccgggtc
gccaccgcgctcaaccccacggcctccaccctggccctcgccggctccaccgagtcggcc
cagttctga

DBGET integrated database retrieval system