KEGG   Xylanimonas cellulosilytica: Xcel_0989Help
Entry
Xcel_0989         CDS       T01135                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic anchor subunit-like protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
xce  Xylanimonas cellulosilytica
Pathway
xce00020  Citrate cycle (TCA cycle)
xce00190  Oxidative phosphorylation
xce00650  Butanoate metabolism
xce01100  Metabolic pathways
xce01110  Biosynthesis of secondary metabolites
xce01120  Microbial metabolism in diverse environments
xce01130  Biosynthesis of antibiotics
xce01200  Carbon metabolism
Module
xce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xce_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xce_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Xcel_0989
   00650 Butanoate metabolism
    Xcel_0989
  Energy metabolism
   00190 Oxidative phosphorylation
    Xcel_0989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS SSF SLC3A2_N
Motif
Other DBs
NCBI-ProteinID: ACZ30020
JGI: Xcel_0989
UniProt: D1BYU5
Position
complement(1065236..1065703)
Genome map
AA seq 155 aa AA seqDB search
MDQQNTALIADPRAPYVRQRTTRSNFELYGWIFMRASGVLLLVLVFGHLFVNLMTGEGVH
SIDFGFVGGKWATPFWQIWDLLMLWLAMIHGTNGVRTIVNDYASKDATRLVLKSLLYLAF
VIVVVLGTLVIFTFDPCPPGATAELLPSFCPAAGA
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggaccagcagaacacggcgctgatcgccgacccccgcgccccctacgtgcggcagcgg
accacgcgctcgaacttcgagctgtacggctggatcttcatgcgcgcctccggcgtgctg
ctcctcgtgctggtcttcgggcacctgttcgtcaacctcatgaccggcgagggcgtccac
tcgatcgacttcgggttcgtcggcggcaagtgggccaccccgttctggcagatctgggac
ctgctcatgctgtggctcgcgatgatccacggcaccaacggcgtgcgcacgatcgtcaac
gactacgcgtccaaggacgccacccgcctggtgctcaagtccctgctctacctggcgttc
gtcatcgtcgtcgtgctcggcacgctcgtgatcttcacgttcgacccgtgcccgcccggc
gccaccgccgagctcctgccgtcgttctgccccgccgccggcgcctga

DBGET integrated database retrieval system