KEGG   Xylanimonas cellulosilytica: Xcel_0999Help
Entry
Xcel_0999         CDS       T01135                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Xcel_0999
Enzymes [BR:xce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Xcel_0999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1074843..1076141
Genome map
AA seq 432 aa AA seqDB search
MSTEPFDAVDVIRTKRDRGVLSPEQIDWVIDAYTRGAVADEQMSALGMAIFLNGMNRAEI
ARWTHAMIESGERLGFENLGVPTSDKHSTGGVGDKITLPLAPLVAAFGVAVPQLSGRGLG
HTGGTLDKLESIPGWRADLTNDEVFAQLRSVGAVICAAGPNLAPADKKLYALRDVTSIVD
CVPLISSSIMSKKIAEGTDALVLDVKVGSGAFMKTLDDARELARTMVDLGTDAGVTTVAL
LTDMSTPLGLTAGNAVEVQESLDVLAGGGPSDVVDLTVALAVEMLAAAGRPRGEDEVRAA
LSDGRAMDRWRSMIAAQGGDVDAPLPVAHESEQVLAPADGVLSRLDALAVGVAAWRLGAG
RARKEDPVQAGAGVVLHAKPGDVVRAGQPLLTLHTDTPERFARALEALDGGWDIAAPGTP
VARTHVVIDRID
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgagccgttcgacgccgtcgacgtcatccgcaccaagcgggaccgcggcgtg
ctgtcgcccgagcagatcgactgggtcatcgacgcgtacacgcgcggcgccgtcgccgac
gagcagatgtcggcgctcggcatggcgatcttcctcaacgggatgaaccgcgccgagatc
gcccggtggacccacgcgatgatcgagtccggtgagcggttggggttcgagaacctgggc
gtcccgacgtcggacaagcactccaccggcggcgtcggcgacaagatcaccctgccgctg
gcccccctcgtggcggcgttcggggtggcggtgccgcagctctccggccgcgggctgggg
cacacgggaggcacgctcgacaagctcgagtcgatccccggctggcgcgccgacctcacc
aacgacgaggtgttcgcccagctccggtcggtcggggcggtcatctgcgcggccggaccg
aacctcgcccccgccgacaagaagctctacgcgctgcgcgacgtcacctcgatcgtcgac
tgcgtccccctgatctccagctcgatcatgagcaagaagatcgccgagggcaccgacgcg
ctcgtcctcgacgtcaaggtgggctccggggcgttcatgaagacgctcgacgacgcccgc
gagctcgcccgcaccatggtcgacctcggcacggacgccggggtcaccacggtcgccctg
ctcaccgacatgtcgacgccgctggggctgaccgcgggcaacgccgtcgaggtgcaggag
tcgctcgacgtgctcgccggcggcgggccgtccgacgtcgtcgacctcaccgtggcgctc
gccgtcgagatgctcgcggcggccgggcggccgcgcggcgaggacgaggtccgggcggcg
ctgtccgacgggcgggccatggacaggtggcggtccatgatcgccgcgcagggcggcgac
gtggacgcgcccctgcccgtcgcgcacgagtccgaacaggtgctggccccggccgacggc
gtgctgtcgcggctcgacgccctcgccgtcggtgtggccgcctggcgcctcggggccggg
cgggcgcgcaaggaggaccccgtgcaggccggtgcgggcgtggtgctgcacgccaagccc
ggcgacgtcgtccgggccggacagccgctcctgacgctgcacaccgacaccccggagcgg
ttcgcgcgggcgctcgaggcgctcgacggcggctgggacatcgcggcgcccggaaccccc
gtggcacggacccacgtggtgatcgaccggatcgactga

DBGET integrated database retrieval system