KEGG   Xylanimonas cellulosilytica: Xcel_1101Help
Entry
Xcel_1101         CDS       T01135                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Xcel_1101
Enzymes [BR:xce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Xcel_1101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1183295..1185448
Genome map
AA seq 717 aa AA seqDB search
MTQTTPPDEIPAELRELSHVHGVRTEFYGFDGTPVQVRASTLVAVLEALGVPATTRNQVQ
MSLALARDDEWRQALPPTVVVRQGIDATVPVHVTDGSTVQVWVELDGAEPLAARRGHRER
RDLPQVEHYVEPRMVDGRRIGRATFAVPADLPLGWHTLHATSDGAEAKTTLVVTPQRLTL
PPAVEQGQVWGLLVQLYSVRSRTSWGLGDLADLADIAWLAAHRGGADFVAINPLAAAEPT
VPMTPSPYLPTSRRFLNPIYVRVEDILETAYLSAADRSLVEWAAEPVRDRATDPGPIDRD
AVWEAKKAALEVVFTAPRRAARQAAYEEFVTEQGAGLRDFATWCAITEHLAGKDWPRELS
TPDAPAVRALRERLRERVEFHMWLQWVADEQKTVAQRTAREAGMKIGIMHDLAVGVHPEG
ADAWANGAYLARGVEVGAPPDMYNQQGQNWSQPPWNPRALAKAGYAPYRDMLRTVLRSAG
ALRADHILGLFRLWWIPGGSKASAGTYVAYDHEAMVGILCLEAHRAGAVVVGEDLGVFEP
WVRDYLADRGILGTSVMWFEQENGGPLPPEKYRHLTMASVGTHDMPPTAGYLAGEHVDLR
ERLGLLTEPVEVVRRRARAEREVFVRVLVERGLVREDASEREIVEAMHRYLRQTPSALFG
VQLVDMVGERRSQNQPGTDQEYPNWKVPLGDANGNPILLEDLFDSQRLRSLIEALNA
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
gtgacccagacgacgccgcccgacgagattcccgccgagctccgggagctctcgcacgtg
cacggggtgcgcaccgagttctacggcttcgacggcacgccggtccaggtgcgcgcctcg
acgctcgtcgcggtcctggaggcgctcggcgtccccgcgaccacgcgcaaccaggtccag
atgtccctcgcgctcgcccgcgacgacgagtggcgccaggcgctgccgcccaccgtcgtc
gtccgccagggcatcgacgccaccgtgcccgtccacgtcaccgacggctccacggtccag
gtctgggtcgagctcgacggcgcggagccgctcgcggcgcggcgcggccatcgcgagcgc
cgcgacctgccgcaggtcgagcactacgtcgagccgcgcatggtggacgggcgccgcatc
gggcgcgcgaccttcgccgtcccggccgacctgccgctcggctggcacacgctgcacgcc
acgtccgacggcgcggaggcgaagaccaccctcgtcgtgacgccgcagcgcctcacgctg
ccgcccgccgtcgagcaggggcaggtctgggggctgctggtgcagctctactcggtgcgc
tcgcgcacctcgtgggggctgggcgacctcgccgacctcgccgacatcgcctggctggcc
gcgcaccgtggcggcgccgacttcgtcgcgatcaacccgctcgcggccgccgagcccacg
gtgccgatgacgccgtcgccctacctgcccacctcgcgccggttcctcaacccgatctac
gtgcgcgtcgaggacatcctggagacggcgtacctctcggccgccgaccgctcgctggtc
gagtgggccgccgagccggtgcgtgaccgggccacggacccgggccccatcgaccgcgac
gccgtctgggaggccaagaaggccgccctcgaggtcgtgttcacggccccgcggcgtgcc
gcccgtcaggccgcctacgaggagttcgtcaccgagcagggcgccggcctgcgcgacttc
gccacctggtgcgcgatcaccgagcacctggccggcaaggactggccgcgcgagctgtcc
accccggacgcgcccgccgtgcgcgcgctgcgcgagcggctgcgcgagcgcgtcgagttc
cacatgtggttgcagtgggtggcagacgagcagaagacggtcgcgcagcggacggcgcgt
gaggccgggatgaagatcggcatcatgcacgacctcgccgtcggcgtgcaccccgagggt
gccgacgcgtgggcgaacggcgcctacctggcccgcggcgtcgaggtcggcgccccgccg
gacatgtacaaccagcaggggcagaactggtcgcagccgccgtggaacccccgcgcgctc
gccaaggccgggtacgccccctaccgcgacatgctgcgcacggtgctgcgctccgcgggc
gcgctgcgcgccgaccacatcctcggcctgttccggctgtggtggatcccgggcggctcg
aaggcgtccgccggcacgtacgtcgcgtacgaccacgaggcgatggtgggcatcctgtgc
ctggaggcgcaccgggccggcgccgtcgtcgtcggcgaggacctgggcgtgttcgagccg
tgggtgcgcgactacctcgccgaccgcggcatcctcggcacgtcggtcatgtggttcgag
caggagaacggcgggccgctgccccccgagaagtaccggcacctgaccatggcgtccgtg
ggcacgcacgacatgccgccgaccgccgggtacctcgccggcgagcacgtggacctgcgc
gagcggctcgggctgctcaccgagccggtcgaggtcgtccgccgccgtgcccgcgccgag
cgcgaggtcttcgtgcgggtactggtcgagcgtgggctcgtgcgcgaggacgcctcggag
cgcgagatcgtcgaggccatgcaccggtacctgcgccagacgccgtcggcgctgttcggc
gtccagctcgtcgacatggtgggggagcggcggtcgcagaaccagcccggcaccgaccag
gagtacccgaactggaaggtgccgctgggcgacgctaacggcaacccgatcctcctggag
gacctcttcgacagccagcgcctgcgcagcctcatcgaggcgctgaacgcctga

DBGET integrated database retrieval system