KEGG   Xylanimonas cellulosilytica: Xcel_1193Help
Entry
Xcel_1193         CDS       T01135                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xce00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1289710..1291764
Genome map
AA seq 684 aa AA seqDB search
MPHIMDRLTAELGLLYGGDYNPEQWDPSVWREDARLMREAGVNLVTVGVFSWARYEPEPG
VRDFAWLDEVLDVLQAHGIAVDLATPTASPPPWLGIDHPETLPVDRDGVRLVAGSRNQFA
PSSRVYREAALAITCDLAARYARHPAVRMWHVGNEYGQVDFGDEAAREFRAWLHDRYGSI
DALNEAWGTAFWSQRYRDFEDVLPPRRAPYLVNPTQALDFRRFTSDELLACYREQHAALR
EAGVTAPITTNFMGFFPGADYWRWADAVDVVADDQYPDHADPRSPADAALVQDLMRGLGG
GAPWLLLEQAAGATSWREHNLPKSPERMRLDSLQAVARGADGVCFFQWRASTAGAERFHS
AMLPHAGPDTAVHRGVRRLGTDLARLHPVIGSRVAARTALLFDWESWWAAEEPGRITERL
RTLDQVRAYYRPLWDRGVAVDVVRPGAALDAYDVVVVPQTYLLDDDAATSLRAAAEGGAC
VVVGPMTGVADRNAHVLPGRFPVRLADVLGVSGEEWVALPDGGVPVTGALVTGTPGKGSA
HTHAELLRADDAEVLSRFADGHLAGAPAVTRRDVPGGGAAWYVGAVLDEPLLAAVLDDAL
TRAGVPAAVPGAVGLDDVEAVVRGDVVFLLNRGGETARVAVPGTWTDLLTGDDVIDVVDL
PPHDAAVLHPAQPRNQGTGDDEVH
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
gtgccacacatcatggaccgcctcaccgcggaactcggcctgctgtacgggggcgactac
aaccccgagcagtgggacccgtcggtgtggcgcgaggatgccaggctcatgcgcgaggcg
ggcgtgaacctcgtgaccgtcggcgtcttctcctgggcgcgctacgagcccgaacccggt
gtgcgcgacttcgcgtggctcgacgaggtgctcgacgtgctgcaggcgcacggcatcgcc
gtcgacctggcgaccccgacggcgtcgccgccgccgtggctgggcatcgaccaccccgag
accttgcccgtggaccgcgacggcgtgcgcctggtggcggggtcccgcaaccagttcgcc
ccgtcgtcgcgcgtgtaccgcgaggcggccctggccatcacgtgcgacctcgccgcccgc
tacgcccggcaccccgcggtgcgcatgtggcacgtcgggaacgagtacgggcaggtcgac
ttcggtgacgaggctgcgcgggagttccgcgcctggctgcacgaccgctacggcagcatc
gacgcgctcaacgaggcgtggggcacggccttctggtcccagcggtaccgcgacttcgag
gacgtgctgccgccgcgccgtgcgccgtacctggtcaaccccacgcaggcgctcgacttc
cggcgcttcacctccgacgagctgctggcctgctaccgcgagcagcacgccgcgctgcgc
gaggcgggggtcaccgcgccgatcaccaccaacttcatgggcttcttcccgggtgcggac
tactggcggtgggcggatgcggtcgacgtcgtcgccgacgaccagtaccccgaccacgcc
gacccccgctcgccggccgatgccgcgctcgtccaggacctcatgcgcgggctcggcggg
ggtgcgccctggctgctgctcgaacaggccgccggggcgacgtcgtggcgggagcacaac
ctgcccaagtcgccggagcggatgcgcctcgactcgctgcaggccgtggcccgcggcgcg
gacggcgtctgcttcttccagtggcgggcctcgacggccggggccgagcggttccactcg
gcgatgctgccgcacgccggcccggacacggcggtgcaccgcggggtccgccgcctgggc
accgacctcgcccgcctgcacccggtgatcggctcccgcgtggcggcccgcaccgcgctg
ctgttcgactgggagtcgtggtgggccgcggaggagcccggccgcatcaccgagcggttg
cgcaccctcgaccaggtccgcgcgtactaccgcccgctgtgggaccgcggtgtcgccgtc
gacgtcgtgcggcccggtgccgccctcgacgcgtacgacgtcgtcgtcgtcccgcagacc
tatctgctcgacgacgacgccgcgacgtcgctgcgggccgcggccgagggcggcgcctgc
gtcgtcgtcgggccgatgaccggggtcgcggaccgcaacgcgcacgtgctgccgggccgg
ttccccgtacggctcgcggacgtgctcggcgtcagcggcgaggagtgggtcgcgttgccc
gacggcggcgtgccggtcacgggcgcactggtcacgggcacgccgggcaaggggagcgcg
cacacccacgccgagctgctgcgcgccgacgacgccgaggtgctctcccgcttcgccgac
ggccacctcgccggggcacccgcggtcacacggcgcgacgtccccggtggcggcgcggcc
tggtacgtcggcgccgtcctcgacgagccgctgctggcggcggtgctcgacgacgcgctg
acccgcgcgggcgtgcccgccgcggtgcccggcgccgtcgggctcgacgacgtcgaggcc
gtggtccgcggcgacgtcgtcttcctcctcaaccggggcggggagaccgcgcgcgtcgcg
gtgcccggcacctggaccgacctgctcacgggcgacgacgtgatcgacgtcgtcgacctg
cccccgcacgacgccgcggtgctgcacccggcccagccacggaaccaaggaacgggtgac
gatgaagttcactga

DBGET integrated database retrieval system