KEGG   Xylanimonas cellulosilytica: Xcel_1479Help
Entry
Xcel_1479         CDS       T01135                                 

Definition
cysteine/1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase (EC:6.1.1.16)
Orthology
K15526  
L-cysteine:1D-myo-inositol 2-amino-2-deoxy-alpha-D-glucopyranoside ligase [EC:6.3.1.13]
Organism
xce  Xylanimonas cellulosilytica
Brite
Enzymes [BR:xce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.13  L-cysteine:1D-myo-inositol 2-amino-2-deoxy-alpha-D-glucopyranoside ligase
     Xcel_1479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1604234..1605448
Genome map
AA seq 404 aa AA seqDB search
MRTWPTPDVPPLPRTGAPAPVLVHDSTTQSLVEAAPGATATLYACGITPYDATHLGHANT
YLAFDLLQRAWLDAGKTVVYTSNVTDVDDPLLERATATGVDWRELAREQTELYRTDMTAL
RMLPPATWTGAVESIPAVVEAVTALLDAGAAYRVDADVYADLSADPGFGRVAGLDDATMR
ALFAERGGDPDRPGKKHPLDPALWRGEQPGEPSWDGGKLGPGRPGWHIECAVIARDGLGL
PFDVQGGGADLLFPHHEMSTSHARLLAGGAARVHVHAGLLAYDGHKMSKSRGNLVFVSRL
LAAGTDPMTVRLALLAHHYREEWEWTDVELRTAQRRLDTWTSAILSTHDDGEPADTVLDA
VRAALAADLDAPAALAAVDRWAANPGGDAGVVVATVDALLGIEL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacctggcccacgccggacgtcccgccgctgccccgcacgggcgcgcccgcgccc
gtgctcgtgcacgactcgacgacgcagtccctcgtggaggccgcccccggcgccaccgcc
acgctctacgcctgcggcatcacgccctacgacgccacccacctcgggcacgccaacacc
tacctggcgttcgacctgctccagcgggcgtggctcgacgcgggcaagacggtcgtctac
acctcgaacgtcaccgacgtcgacgatcccctgctcgagcgcgcgacggcgaccggtgtc
gactggcgcgagctggcccgcgagcagaccgagctctaccgcaccgacatgaccgcgctg
cgcatgctcccgcccgccacctggaccggtgccgtcgagtccatccccgccgtcgtcgag
gccgtcaccgccctgctcgacgccggagccgcctatcgggtcgacgccgacgtctacgcc
gacctctccgccgaccccggcttcggccgcgtcgccgggctcgacgacgccaccatgcgc
gccctgttcgccgagcgcggcggcgaccccgaccgccccggcaagaagcaccccctcgac
ccggcgctgtggcgcggcgagcagcccggcgagccctcctgggacggcggcaagctcggc
cctggccgacccggctggcacatcgagtgcgccgtcatcgcccgcgacgggctcggcttg
ccgttcgacgtccagggcgggggagccgacctgctcttcccgcaccacgagatgtcgacg
tcgcacgcgcgcctgctcgcgggcggcgccgcacgcgtccacgtgcacgccgggctgctc
gcctacgacggccacaagatgagcaagtcgcgcggcaacctcgtgttcgtctcccggctg
ctggcggccggcaccgatcccatgaccgtccgcctcgccctgctcgcgcaccactaccgc
gaggagtgggaatggaccgacgtcgagctgcgcaccgcccagcggcgcctcgacacatgg
acctccgcgatcctgtccacgcacgacgacggcgagcccgccgacaccgtgctcgacgcc
gtgcgcgcggccctcgcggcggacctcgacgcgccggcggcgctcgcagccgtcgaccgg
tgggcggcgaaccccggcggtgacgccggcgtcgtcgtcgcgacggtcgacgcgctcctc
gggatcgagctgtag

DBGET integrated database retrieval system