KEGG   Xylanimonas cellulosilytica: Xcel_1499Help
Entry
Xcel_1499         CDS       T01135                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xce  Xylanimonas cellulosilytica
Pathway
xce00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xce01100  Metabolic pathways
xce01110  Biosynthesis of secondary metabolites
xce01130  Biosynthesis of antibiotics
xce01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Xcel_1499
Enzymes [BR:xce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Xcel_1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth Gln-synt_N_2 DHO_dh
Motif
Other DBs
NCBI-ProteinID: ACZ30529
JGI: Xcel_1499
UniProt: D1BS37
Position
1625239..1626066
Genome map
AA seq 275 aa AA seqDB search
MTTVLEGIVAGVLEDLAVRQAATSLDELKERAARAPGALEVVSRLRKQDSVAVIAEVKRS
SPSKGSLAPITDPAALAAEYATGGASVISVLTEQRRFGGSLADLDAVRARVDVPVLRKDF
VVTPYQVWEARAHGADVVLLIVAALEQTVLTSLVERVHSLGMTALVEAHTADEVARALDA
GARVVGVNARNLKTLEVDRGVFAALSPLIPDDVVRVAESGVRGPHDVMDYARAGAHAVLV
GEALVTGEAPRRSVADLVAAGQHPSLWSVRPAAQS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggtcctcgaggggatcgtcgcgggcgtcctggaagacctcgccgtccggcag
gccgcgacgagcctcgacgagctcaaggagcgcgccgcgcgcgccccgggcgcgctcgag
gtcgtctcccgcctgcgcaagcaggactccgtcgccgtgatcgccgaggtcaagcgctcc
agcccgtccaagggctcgctcgccccgatcaccgacccggcggcgctcgccgccgagtac
gccacgggtggcgcgtcggtcatctcggtgctcaccgagcagcgccggttcggcggctcg
ctcgccgacctggacgccgtgcgcgcccgcgtcgacgtgccggtgctgcgcaaggacttc
gtcgtcacgccctaccaggtgtgggaggcgcgtgcgcacggcgccgacgtcgtcctgctc
atcgtggcggccctcgagcagaccgtgctgacctcgctggtcgagcgagtccactcgctc
gggatgacggccctggtcgaggcgcacaccgccgacgaggtcgcccgggcgctcgacgcc
ggcgcccgcgtcgtgggcgtcaacgcccgcaacctcaagacgctcgaggtcgaccgcggc
gtgttcgcggcgctgtcccccctcatccccgacgacgtcgtgcgcgtcgccgagtccggc
gtgcgcgggccgcacgacgtcatggactacgcccgggccggcgcccacgccgtgctcgtc
ggcgaggcgctcgtgaccggcgaggctccccgccgctcggtggccgacctcgtggcggcg
gggcagcacccgtcgctgtggtcggtccggccggccgcgcagtcctga

DBGET integrated database retrieval system