KEGG   Xylanimonas cellulosilytica: Xcel_1499Help
Entry
Xcel_1499         CDS       T01135                                 

Definition
Indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Xcel_1499
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Xcel_1499
Enzymes [BR:xce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Xcel_1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1625239..1626066
Genome map
AA seq 275 aa AA seqDB search
MTTVLEGIVAGVLEDLAVRQAATSLDELKERAARAPGALEVVSRLRKQDSVAVIAEVKRS
SPSKGSLAPITDPAALAAEYATGGASVISVLTEQRRFGGSLADLDAVRARVDVPVLRKDF
VVTPYQVWEARAHGADVVLLIVAALEQTVLTSLVERVHSLGMTALVEAHTADEVARALDA
GARVVGVNARNLKTLEVDRGVFAALSPLIPDDVVRVAESGVRGPHDVMDYARAGAHAVLV
GEALVTGEAPRRSVADLVAAGQHPSLWSVRPAAQS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggtcctcgaggggatcgtcgcgggcgtcctggaagacctcgccgtccggcag
gccgcgacgagcctcgacgagctcaaggagcgcgccgcgcgcgccccgggcgcgctcgag
gtcgtctcccgcctgcgcaagcaggactccgtcgccgtgatcgccgaggtcaagcgctcc
agcccgtccaagggctcgctcgccccgatcaccgacccggcggcgctcgccgccgagtac
gccacgggtggcgcgtcggtcatctcggtgctcaccgagcagcgccggttcggcggctcg
ctcgccgacctggacgccgtgcgcgcccgcgtcgacgtgccggtgctgcgcaaggacttc
gtcgtcacgccctaccaggtgtgggaggcgcgtgcgcacggcgccgacgtcgtcctgctc
atcgtggcggccctcgagcagaccgtgctgacctcgctggtcgagcgagtccactcgctc
gggatgacggccctggtcgaggcgcacaccgccgacgaggtcgcccgggcgctcgacgcc
ggcgcccgcgtcgtgggcgtcaacgcccgcaacctcaagacgctcgaggtcgaccgcggc
gtgttcgcggcgctgtcccccctcatccccgacgacgtcgtgcgcgtcgccgagtccggc
gtgcgcgggccgcacgacgtcatggactacgcccgggccggcgcccacgccgtgctcgtc
ggcgaggcgctcgtgaccggcgaggctccccgccgctcggtggccgacctcgtggcggcg
gggcagcacccgtcgctgtggtcggtccggccggccgcgcagtcctga

DBGET integrated database retrieval system