KEGG   Xylanimonas cellulosilytica: Xcel_1500Help
Entry
Xcel_1500         CDS       T01135                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Xcel_1500
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Xcel_1500
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Xcel_1500
Enzymes [BR:xce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Xcel_1500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
1626121..1627419
Genome map
AA seq 432 aa AA seqDB search
MNQEHPVSDALSSTLAHQVLGRLSEQPGPYFGEFGGRWVPEALIAALDELEVEYRKAVED
PAYTDELARLHREYVGRPSPLTEVTRFAQHCGGDAGNRVFLKREDLNHTGSHKINNVLGQ
ALLVKRMGKTRVIAETGAGQHGVATATAAALLDLECVVYMGEEDTRRQALNVARMRLLGA
TVVPVTIGQRTLKDAINEALRDWVANVETTHYLLGTVTGPHPFPEMVRELHKIIGEEARE
QILERTGRLPDVAAACVGGGSNALGLFNAFLDDPSVALFGFEAGGEGIESGRHASRFQGG
VPGVLHGARSYLLQDDDGQTLPSHSVSAGLDYPSVGPAHSWLHDLGRATYRPVTDDEAME
AFRVLCRTEGIIPAIESAHALAGAMQVGTELAAEGKRDQIILVNLSGRGDKDVATAARWF
GLLDDATSEGDQ
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccaggaacaccccgtgagcgacgccctgtcgtccacgctcgcccaccaggtcctg
ggacggctgtccgaacagcccggcccgtacttcggcgagttcggcggacgctgggtgccc
gaggcgctgatcgccgcgctcgacgagctcgaggtggagtaccgcaaggcggtcgaggac
ccggcgtacaccgacgagctggcccgcctgcaccgtgagtacgtgggccgcccgtcgccg
ctgaccgaggtcacccggttcgcgcagcactgcggcggcgacgccggcaaccgcgtgttc
ctcaagcgcgaggacctcaaccacaccggctcgcacaagatcaacaacgtgctgggccag
gcgctgctggtcaagcgcatgggcaagacgcgcgtgatcgcggagacgggcgcaggccag
cacggcgtcgccacggcgacggcggccgcgctgctcgacctggagtgcgtcgtctacatg
ggcgaggaggacaccaggcgccaggcgctcaacgtggcgcgcatgcgcctgctgggcgcc
accgtcgtccccgtgacgatcgggcagcgcacgctcaaggacgcgatcaacgaggccctg
cgcgactgggtcgccaacgtcgagacgacgcactacctgctcggcaccgtgaccggcccg
cacccgttccccgagatggtccgcgagctgcacaagatcatcggcgaggaggcccgcgag
cagatcctcgagcgcaccggccggctgcccgacgtcgccgcggcgtgcgtgggcggcggg
tcgaacgcgctgggcctgttcaacgcgttcctcgacgacccgtcggtcgcgctgttcggc
ttcgaggccggcggcgagggcatcgagtcggggcggcacgcgtcgcgcttccagggcggc
gtccccggcgtcctgcacggcgcccgctcctacctgctccaggacgacgacggccagacg
ctcccgagccactcggtctcggccgggctggactacccgagcgtcggcccggcccactcc
tggctgcacgacctcggccgcgcgacctaccgcccggtcacggacgacgaggccatggag
gccttccgggtcctgtgccgcaccgagggcatcatccccgccatcgagtccgcccacgcg
ctcgccggggccatgcaggtcggcaccgagctcgccgccgagggcaagcgcgaccagatc
atcctggtcaacctgtcgggccgtggcgacaaggacgtggcgaccgccgcccgctggttc
gggctgctcgacgacgccacctcggagggggaccagtga

DBGET integrated database retrieval system