KEGG   Xylanimonas cellulosilytica: Xcel_1500Help
Entry
Xcel_1500         CDS       T01135                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Xcel_1500
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Xcel_1500
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Xcel_1500
Enzymes [BR:xce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Xcel_1500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1626139..1627419
Genome map
AA seq 426 aa AA seqDB search
MSDALSSTLAHQVLGRLSEQPGPYFGEFGGRWVPEALIAALDELEVEYRKAVEDPAYTDE
LARLHREYVGRPSPLTEVTRFAQHCGGDAGNRVFLKREDLNHTGSHKINNVLGQALLVKR
MGKTRVIAETGAGQHGVATATAAALLDLECVVYMGEEDTRRQALNVARMRLLGATVVPVT
IGQRTLKDAINEALRDWVANVETTHYLLGTVTGPHPFPEMVRELHKIIGEEAREQILERT
GRLPDVAAACVGGGSNALGLFNAFLDDPSVALFGFEAGGEGIESGRHASRFQGGVPGVLH
GARSYLLQDDDGQTLPSHSVSAGLDYPSVGPAHSWLHDLGRATYRPVTDDEAMEAFRVLC
RTEGIIPAIESAHALAGAMQVGTELAAEGKRDQIILVNLSGRGDKDVATAARWFGLLDDA
TSEGDQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacgccctgtcgtccacgctcgcccaccaggtcctgggacggctgtccgaacag
cccggcccgtacttcggcgagttcggcggacgctgggtgcccgaggcgctgatcgccgcg
ctcgacgagctcgaggtggagtaccgcaaggcggtcgaggacccggcgtacaccgacgag
ctggcccgcctgcaccgtgagtacgtgggccgcccgtcgccgctgaccgaggtcacccgg
ttcgcgcagcactgcggcggcgacgccggcaaccgcgtgttcctcaagcgcgaggacctc
aaccacaccggctcgcacaagatcaacaacgtgctgggccaggcgctgctggtcaagcgc
atgggcaagacgcgcgtgatcgcggagacgggcgcaggccagcacggcgtcgccacggcg
acggcggccgcgctgctcgacctggagtgcgtcgtctacatgggcgaggaggacaccagg
cgccaggcgctcaacgtggcgcgcatgcgcctgctgggcgccaccgtcgtccccgtgacg
atcgggcagcgcacgctcaaggacgcgatcaacgaggccctgcgcgactgggtcgccaac
gtcgagacgacgcactacctgctcggcaccgtgaccggcccgcacccgttccccgagatg
gtccgcgagctgcacaagatcatcggcgaggaggcccgcgagcagatcctcgagcgcacc
ggccggctgcccgacgtcgccgcggcgtgcgtgggcggcgggtcgaacgcgctgggcctg
ttcaacgcgttcctcgacgacccgtcggtcgcgctgttcggcttcgaggccggcggcgag
ggcatcgagtcggggcggcacgcgtcgcgcttccagggcggcgtccccggcgtcctgcac
ggcgcccgctcctacctgctccaggacgacgacggccagacgctcccgagccactcggtc
tcggccgggctggactacccgagcgtcggcccggcccactcctggctgcacgacctcggc
cgcgcgacctaccgcccggtcacggacgacgaggccatggaggccttccgggtcctgtgc
cgcaccgagggcatcatccccgccatcgagtccgcccacgcgctcgccggggccatgcag
gtcggcaccgagctcgccgccgagggcaagcgcgaccagatcatcctggtcaacctgtcg
ggccgtggcgacaaggacgtggcgaccgccgcccgctggttcgggctgctcgacgacgcc
acctcggagggggaccagtga

DBGET integrated database retrieval system