KEGG   Xylanimonas cellulosilytica: Xcel_1501Help
Entry
Xcel_1501         CDS       T01135                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Xcel_1501
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Xcel_1501
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Xcel_1501
Enzymes [BR:xce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Xcel_1501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1627416..1628246
Genome map
AA seq 276 aa AA seqDB search
MSTTIASQTGARLDALTAQGRPALMGYLPVGFPTVDRSIEALCAAIDAGLDVVELGLPYT
DPVMDGPVIQRAAEEALQGGTRVTDLFRVVAALRAHAPHVPVLVMSYWNLVLRYGVDRFA
ADLAAAGGAGLITPDLIPDEAREWISASDAHGLDRVFLVAPSSTPQRLRLTADASRGFVY
AASTMGVTGTRAAVGEAAQQLVADTRAAGAARVCVGLGVSTGDQAAQVGAYADGVIVGSA
LVRTLQGEAPWAQKVASLQAVTAELAAGVARARKDG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccaccatcgcctcgcagaccggcgcgcgcctcgacgcgctgacggcgcagggc
cggcccgcgctgatgggctacctgcccgtcggcttcccgaccgtcgaccggtcgatcgag
gcgctctgcgcggcgatcgacgcgggcctcgacgtcgtcgagctgggcctgccgtacacc
gacccggtcatggacggcccggtcatccagcgggccgccgaggaggcgctgcagggcggc
acgcgcgtcacggacctcttccgcgtcgtcgccgcgctgcgggcgcacgccccgcacgtg
cccgtgctggtcatgagctactggaacctggtgctgcgctacggcgtggaccggttcgcc
gccgacctggccgccgccgggggcgcgggcctgatcacccccgacctcatccccgacgag
gcccgggagtggatctcggcctcggacgcgcacggcctggaccgcgtgttcctcgtggcg
ccgagctcgacgccgcagcggctgcgcctgacggcggacgcctcgcgcgggttcgtgtac
gcggcgtccacgatgggcgtcaccggcacccgtgccgccgtcggcgaggcggcgcagcag
ctcgtcgcggacacccgtgccgcgggcgccgcgcgcgtgtgcgtcggcctcggcgtctcc
acgggcgaccaggcggcccaggtgggcgcctacgccgacggggtgatcgtcgggtcggcc
ctggtgcgcacgctccagggtgaggcaccctgggcacagaaggtcgcgagcctgcaggcc
gtgaccgccgagctcgccgcgggcgtcgcccgcgcccggaaggacggctga

DBGET integrated database retrieval system