KEGG   Xylanimonas cellulosilytica: Xcel_1501Help
Entry
Xcel_1501         CDS       T01135                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xce01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:xce00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:xce00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1627416..1628246
Genome map
AA seq 276 aa AA seqDB search
MSTTIASQTGARLDALTAQGRPALMGYLPVGFPTVDRSIEALCAAIDAGLDVVELGLPYT
DPVMDGPVIQRAAEEALQGGTRVTDLFRVVAALRAHAPHVPVLVMSYWNLVLRYGVDRFA
ADLAAAGGAGLITPDLIPDEAREWISASDAHGLDRVFLVAPSSTPQRLRLTADASRGFVY
AASTMGVTGTRAAVGEAAQQLVADTRAAGAARVCVGLGVSTGDQAAQVGAYADGVIVGSA
LVRTLQGEAPWAQKVASLQAVTAELAAGVARARKDG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccaccatcgcctcgcagaccggcgcgcgcctcgacgcgctgacggcgcagggc
cggcccgcgctgatgggctacctgcccgtcggcttcccgaccgtcgaccggtcgatcgag
gcgctctgcgcggcgatcgacgcgggcctcgacgtcgtcgagctgggcctgccgtacacc
gacccggtcatggacggcccggtcatccagcgggccgccgaggaggcgctgcagggcggc
acgcgcgtcacggacctcttccgcgtcgtcgccgcgctgcgggcgcacgccccgcacgtg
cccgtgctggtcatgagctactggaacctggtgctgcgctacggcgtggaccggttcgcc
gccgacctggccgccgccgggggcgcgggcctgatcacccccgacctcatccccgacgag
gcccgggagtggatctcggcctcggacgcgcacggcctggaccgcgtgttcctcgtggcg
ccgagctcgacgccgcagcggctgcgcctgacggcggacgcctcgcgcgggttcgtgtac
gcggcgtccacgatgggcgtcaccggcacccgtgccgccgtcggcgaggcggcgcagcag
ctcgtcgcggacacccgtgccgcgggcgccgcgcgcgtgtgcgtcggcctcggcgtctcc
acgggcgaccaggcggcccaggtgggcgcctacgccgacggggtgatcgtcgggtcggcc
ctggtgcgcacgctccagggtgaggcaccctgggcacagaaggtcgcgagcctgcaggcc
gtgaccgccgagctcgccgcgggcgtcgcccgcgcccggaaggacggctga

DBGET integrated database retrieval system