KEGG   Xylanimonas cellulosilytica: Xcel_1514Help
Entry
Xcel_1514         CDS       T01135                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xcel_1514
   01230 Biosynthesis of amino acids
    Xcel_1514
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xcel_1514
   00030 Pentose phosphate pathway
    Xcel_1514
   00051 Fructose and mannose metabolism
    Xcel_1514
   00052 Galactose metabolism
    Xcel_1514
  Energy metabolism
   00680 Methane metabolism
    Xcel_1514
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Xcel_1514
Enzymes [BR:xce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Xcel_1514
Protein phosphatases and associated proteins [BR:xce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Xcel_1514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1645349..1646380
Genome map
AA seq 343 aa AA seqDB search
MHVRVGLLTGGGDVPGLNAAIRAVVKRGEGEHGHSIIGFRNGWRGLAEGDVMPLGRQQIR
NVLPIGGTLLGTARYHPHSSDGGMDAVLATLEAERIEALIVVGGDGTLHAASKVAEAGIG
IVAIPKTIDNDVWGTDRSIGFDTAVTIATEAVDRIHTTAESHNRVMIVEVMGRHAGWIAA
TSGIAGGAELVLAPEQPFDIDKIVKFLRHRHRAHASFSIIVVAEGAVPAEGTAMQYETQL
GRFGEIIAGSISERLKVEIAERTGFDTRVTVLGHIQRGGTPTPTDRILGSRFGVAAIDAI
TRGETGVMTALRGDDIVLVPLAEIAGKVKQVPTELLDVAQALA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgcgagtcggactcctgaccggtggcggggatgtccccggcctcaacgccgcg
atccgggcggtggtcaagcggggcgagggcgagcacggccactcgatcatcggtttccgc
aacgggtggcgcggcctcgccgagggcgacgtcatgccgctgggacgccagcagatccgc
aacgtcctgccgatcggcggcacgctgctgggcaccgcgcggtaccacccgcactcctcc
gacggcggcatggacgccgtgctcgccaccctggaggccgagcgcatcgaggccctcatc
gtcgtcggcggcgacggcacgctgcacgcggcgagcaaggtcgccgaggcgggcatcggc
atcgtcgcgatccccaagacgatcgacaacgacgtgtggggcaccgaccgctcgatcggc
ttcgacaccgcggtgaccatcgcgaccgaggccgtcgaccgcatccacaccacggccgag
tcccacaaccgcgtcatgatcgtcgaggtcatggggcggcacgccggctggatcgccgcg
acgtcgggcatcgcgggcggcgccgagctggtgctggcccccgagcagccgttcgacatc
gacaagatcgtcaagttcctgcggcaccgccaccgcgcgcacgcgagcttctcgatcatc
gtggtcgccgagggcgcggtgcccgccgagggcaccgcgatgcagtacgagacgcagctc
ggccggttcggcgagatcatcgccggctcgatctccgagcggctcaaggtcgagatcgcc
gagcgcaccgggttcgacacccgcgtcaccgtgctggggcacatccagcgcggtggcacg
ccgacgccgacggaccgcatcctcggttcgcgcttcggcgtcgcggcgatcgacgcgatc
acgcgcggcgagacgggtgtgatgacggcgctgcgcggcgacgacatcgtgctggtcccg
ctcgccgagatcgccggcaaggtcaagcaggtccccaccgagctgctcgacgtggcgcag
gccctcgcctga

DBGET integrated database retrieval system