KEGG   Xylanimonas cellulosilytica: Xcel_1514Help
Entry
Xcel_1514         CDS       T01135                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
xce  Xylanimonas cellulosilytica
Pathway
xce00010  Glycolysis / Gluconeogenesis
xce00030  Pentose phosphate pathway
xce00051  Fructose and mannose metabolism
xce00052  Galactose metabolism
xce00680  Methane metabolism
xce01100  Metabolic pathways
xce01110  Biosynthesis of secondary metabolites
xce01120  Microbial metabolism in diverse environments
xce01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xcel_1514
   00030 Pentose phosphate pathway
    Xcel_1514
   00051 Fructose and mannose metabolism
    Xcel_1514
   00052 Galactose metabolism
    Xcel_1514
  Energy metabolism
   00680 Methane metabolism
    Xcel_1514
Enzymes [BR:xce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Xcel_1514
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Xcel_1514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase Dimer_Tnp_Tn5
Motif
Other DBs
NCBI-ProteinID: ACZ30544
JGI: Xcel_1514
UniProt: D1BS52
Position
1645349..1646380
Genome map
AA seq 343 aa AA seqDB search
MHVRVGLLTGGGDVPGLNAAIRAVVKRGEGEHGHSIIGFRNGWRGLAEGDVMPLGRQQIR
NVLPIGGTLLGTARYHPHSSDGGMDAVLATLEAERIEALIVVGGDGTLHAASKVAEAGIG
IVAIPKTIDNDVWGTDRSIGFDTAVTIATEAVDRIHTTAESHNRVMIVEVMGRHAGWIAA
TSGIAGGAELVLAPEQPFDIDKIVKFLRHRHRAHASFSIIVVAEGAVPAEGTAMQYETQL
GRFGEIIAGSISERLKVEIAERTGFDTRVTVLGHIQRGGTPTPTDRILGSRFGVAAIDAI
TRGETGVMTALRGDDIVLVPLAEIAGKVKQVPTELLDVAQALA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgcgagtcggactcctgaccggtggcggggatgtccccggcctcaacgccgcg
atccgggcggtggtcaagcggggcgagggcgagcacggccactcgatcatcggtttccgc
aacgggtggcgcggcctcgccgagggcgacgtcatgccgctgggacgccagcagatccgc
aacgtcctgccgatcggcggcacgctgctgggcaccgcgcggtaccacccgcactcctcc
gacggcggcatggacgccgtgctcgccaccctggaggccgagcgcatcgaggccctcatc
gtcgtcggcggcgacggcacgctgcacgcggcgagcaaggtcgccgaggcgggcatcggc
atcgtcgcgatccccaagacgatcgacaacgacgtgtggggcaccgaccgctcgatcggc
ttcgacaccgcggtgaccatcgcgaccgaggccgtcgaccgcatccacaccacggccgag
tcccacaaccgcgtcatgatcgtcgaggtcatggggcggcacgccggctggatcgccgcg
acgtcgggcatcgcgggcggcgccgagctggtgctggcccccgagcagccgttcgacatc
gacaagatcgtcaagttcctgcggcaccgccaccgcgcgcacgcgagcttctcgatcatc
gtggtcgccgagggcgcggtgcccgccgagggcaccgcgatgcagtacgagacgcagctc
ggccggttcggcgagatcatcgccggctcgatctccgagcggctcaaggtcgagatcgcc
gagcgcaccgggttcgacacccgcgtcaccgtgctggggcacatccagcgcggtggcacg
ccgacgccgacggaccgcatcctcggttcgcgcttcggcgtcgcggcgatcgacgcgatc
acgcgcggcgagacgggtgtgatgacggcgctgcgcggcgacgacatcgtgctggtcccg
ctcgccgagatcgccggcaaggtcaagcaggtccccaccgagctgctcgacgtggcgcag
gccctcgcctga

DBGET integrated database retrieval system